| Clone Name | rbaal3a20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SLIT1_HUMAN (O75093) Slit homolog 1 protein precursor (Slit-1) (... | 28 | 6.2 | 2 | CYA1_DROME (P32870) Ca(2+)/calmodulin-responsive adenylate cycla... | 28 | 6.2 | 3 | HRP3_PLAFS (P14586) Histidine-rich protein | 28 | 8.2 |
|---|
>SLIT1_HUMAN (O75093) Slit homolog 1 protein precursor (Slit-1) (Multiple| epidermal growth factor-like domains 4) Length = 1534 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 243 LCNISSFLFYHCRGLRCIGAFHCQA 169 LCN + L CRGL+C+ HCQA Sbjct: 1411 LCNQAGALAEPCRGLQCLHG-HCQA 1434
>CYA1_DROME (P32870) Ca(2+)/calmodulin-responsive adenylate cyclase (EC 4.6.1.1)| (ATP pyrophosphate-lyase) (Protein rutabaga) Length = 2248 Score = 28.1 bits (61), Expect = 6.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 181 SLSSHTLYHRDHHHQIGNKRQQR 113 S H YH HHHQ ++QQR Sbjct: 1946 SQQRHQRYHHHHHHQQRQQQQQR 1968
>HRP3_PLAFS (P14586) Histidine-rich protein| Length = 82 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -1 Query: 172 SHTLYHRDHHHQIGNKRQQRNIFSFSSCLRLRGCIYLVLFALHNK 38 +H LYHR HHH+ R+ + R I+ +L +L+NK Sbjct: 17 NHHLYHRHHHHR---HHHHRHHHRHQILHQNRHQIHQILLSLNNK 58 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,358,228 Number of Sequences: 219361 Number of extensions: 573811 Number of successful extensions: 1520 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1517 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)