| Clone Name | rbags39p24 |
|---|---|
| Clone Library Name | barley_pub |
>CWC25_USTMA (Q4P6I3) Pre-mRNA-splicing factor CWC25| Length = 520 Score = 33.9 bits (76), Expect = 0.42 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = -3 Query: 580 GSLHLKVMYHPFTKEEQLEALESEKKAIEERKRLKE 473 G L+ K +HP + Q + EK+A+EERK+L+E Sbjct: 96 GDLNTKKSWHPLLQVNQERVWKREKEALEERKKLEE 131
>CWC25_ASPFU (Q4X1D7) Pre-mRNA-splicing factor cwc25| Length = 447 Score = 33.9 bits (76), Expect = 0.42 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -3 Query: 580 GSLHLKVMYHPFTKEEQLEALESEKKAIEERKRLKE 473 G L+LK +HP Q EK+A+EERKR+++ Sbjct: 3 GDLNLKKSWHPSLLRNQERVWAEEKRALEERKRIEQ 38
>CWC25_GIBZE (Q4IRI9) Pre-mRNA-splicing factor CWC25| Length = 393 Score = 33.1 bits (74), Expect = 0.72 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -3 Query: 580 GSLHLKVMYHPFTKEEQLEALESEKKAIEERKRLKE 473 G L+LK +HP + Q + E+KA+ ERKR ++ Sbjct: 4 GDLNLKKSFHPALRRNQQAVWDEEQKALAERKRTQQ 39
>CWC25_EMENI (Q5B0I1) Pre-mRNA-splicing factor cwc25| Length = 415 Score = 33.1 bits (74), Expect = 0.72 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -3 Query: 580 GSLHLKVMYHPFTKEEQLEALESEKKAIEERKRLKE 473 G L+LK +HP Q EK+A+EERKR+ + Sbjct: 3 GDLNLKKSWHPSLLRNQERVWAEEKRALEERKRIDQ 38
>CWC25_YARLI (Q6C1V6) Pre-mRNA-splicing factor CWC25| Length = 561 Score = 32.0 bits (71), Expect = 1.6 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -3 Query: 580 GSLHLKVMYHPFTKEEQLEALESEKKAIEERKRLKE 473 G L+LK +HP + Q E++A+EER+R++E Sbjct: 3 GDLNLKKSWHPGLHKNQAVVHAKEQEALEERRRIQE 38
>ARFG_ARATH (P93022) Auxin response factor 7 (Non-phototropic hypocotyl 4)| (Protein BIPOSTO) (Auxin-responsive protein IAA21/IAA23/IAA25) Length = 1164 Score = 30.8 bits (68), Expect = 3.6 Identities = 20/45 (44%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 325 QNLPDQRQHQALSPRAQHP-RQRQCPQIQHLNQLVKRRHQVHPSC 456 Q L Q+Q Q LSP++Q P Q Q Q+Q L L + HQ SC Sbjct: 755 QRLQQQQQQQFLSPQSQLPHHQLQSQQLQQLPTL-SQGHQFPSSC 798
>TCF20_MOUSE (Q9EPQ8) Transcription factor 20 (Stromelysin 1 PDGF-responsive| element-binding protein) (SPRE-binding protein) (Nuclear factor SPBP) Length = 1983 Score = 30.4 bits (67), Expect = 4.7 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 319 QYQNLPDQRQHQALSPRAQHPRQRQCPQIQHLNQLVKRRHQVHP 450 QYQ +Q Q + Q +Q+Q Q+Q L Q + + HQ P Sbjct: 165 QYQQQASSQQQQQQQQQQQQQQQQQQQQVQQLRQQLYQSHQPLP 208
>DHH1_CANAL (Q5AAW3) ATP-dependent RNA helicase DHH1 (EC 3.6.1.-)| Length = 549 Score = 30.0 bits (66), Expect = 6.1 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 301 GRCPRRQYQNLPDQRQHQALSPRAQHP-RQRQCPQIQH 411 G ++Q Q P Q+Q Q+ SP Q P +Q+Q P QH Sbjct: 444 GSSSQQQQQPPPQQQQQQSTSPPQQQPQQQQQQPNPQH 481
>LASP1_DROME (Q8I7C3) LIM and SH3 domain protein Lasp| Length = 657 Score = 30.0 bits (66), Expect = 6.1 Identities = 21/73 (28%), Positives = 31/73 (42%) Frame = +1 Query: 232 YHSYEICPSALSQSSP*TSQLYQGRCPRRQYQNLPDQRQHQALSPRAQHPRQRQCPQIQH 411 Y S ++ SQ +P S + Q Q Q QHQ QH +Q Q Q QH Sbjct: 149 YFSEQLAAEQFSQYAPTASPIPPAATTLHQQQQ---QLQHQQQQQYQQHQQQLQQQQHQH 205 Query: 412 LNQLVKRRHQVHP 450 + L +++ + P Sbjct: 206 QHYLQQQQQTLPP 218
>FEN_SULAC (Q4JAN1) Flap structure-specific endonuclease (EC 3.1.-.-)| Length = 349 Score = 29.6 bits (65), Expect = 8.0 Identities = 15/56 (26%), Positives = 31/56 (55%) Frame = -3 Query: 640 ITLKLMQSLDSLKIKDYRDRGSLHLKVMYHPFTKEEQLEALESEKKAIEERKRLKE 473 IT ++ + + L++ + +R + L V H F ++ +E KKAI+E K +++ Sbjct: 286 ITPEVKKPTERLELAECNEREIIELLVKNHDFNEDRVNNGIERLKKAIKEAKSVEK 341 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,763,172 Number of Sequences: 219361 Number of extensions: 1483871 Number of successful extensions: 6071 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 5690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6053 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)