| Clone Name | rbaal2i09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PTPA1_CRYNE (Q5K9U4) Serine/threonine-protein phosphatase 2A act... | 29 | 8.9 |
|---|
>PTPA1_CRYNE (Q5K9U4) Serine/threonine-protein phosphatase 2A activator 1 (EC| 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase PTPA-1) (PPIase PTPA-1) (Rotamase PTPA-1) (Phosphotyrosyl phosphatase activator 1) Length = 362 Score = 29.3 bits (64), Expect = 8.9 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +3 Query: 123 LTIFNLICSYN*PSPI*TEMSWLSNLLSDHQGLMHMNLNTERGEKLEVNYIGMNLW 290 LT+F S++ SP+ +S + N + H GL M L G+++ V I + W Sbjct: 276 LTLFKFGASFSEHSPLLYSLSQMPNWVKPHGGLKKMFLGEVVGKRVVVQGIWVGGW 331 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,320,193 Number of Sequences: 219361 Number of extensions: 1533949 Number of successful extensions: 3188 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3188 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5158951200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)