| Clone Name | rbags39m09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | STT3_CAEEL (P46975) Oligosaccharyl transferase STT3 subunit homolog | 30 | 4.6 | 2 | FLA2_PYRHO (O58283) Probable flagellin PH0548 | 30 | 4.6 |
|---|
>STT3_CAEEL (P46975) Oligosaccharyl transferase STT3 subunit homolog| Length = 757 Score = 30.4 bits (67), Expect = 4.6 Identities = 12/33 (36%), Positives = 25/33 (75%) Frame = -2 Query: 313 AGLKASIGILIAMVSVIVLVLF*IYTTYVTSPA 215 +G+ +++ +I+++ VI L++F ++ TYVTS A Sbjct: 472 SGVSSNVRTIISIILVIFLLMFVVHATYVTSNA 504
>FLA2_PYRHO (O58283) Probable flagellin PH0548| Length = 207 Score = 30.4 bits (67), Expect = 4.6 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = -2 Query: 472 NATSQAVNVNFTARAERSRVALYSVYYNTRSDDHSSLCGPVIDDVRVWGLNG 317 NA S+ +++ +T RS+ S+YYN RS+ ++ + D VW NG Sbjct: 80 NAGSEGIDLRYTKIVLRSKSQEVSLYYN-RSNYYNGAVDNIFDISGVWPSNG 130 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,990,536 Number of Sequences: 219361 Number of extensions: 1592457 Number of successful extensions: 4710 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4571 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4709 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5881538857 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)