| Clone Name | rbags39m04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FUR2_DROME (P30432) Furin-like protease 2 precursor (EC 3.4.21.7... | 31 | 5.0 | 2 | YKFI_ECOLI (P77692) Hypothetical protein ykfI | 30 | 8.6 |
|---|
>FUR2_DROME (P30432) Furin-like protease 2 precursor (EC 3.4.21.75) (Furin-2)| Length = 1679 Score = 30.8 bits (68), Expect = 5.0 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +2 Query: 428 RGPSLQFRC*ARRLQPLCY-RPPPTSS*NHVGLPWSCSPLC 547 RGP+ C RL C R PP S N VG+ W C C Sbjct: 979 RGPTQCVACSHYRLDNTCVSRCPPRSFPNQVGICWPCHDTC 1019
>YKFI_ECOLI (P77692) Hypothetical protein ykfI| Length = 113 Score = 30.0 bits (66), Expect = 8.6 Identities = 17/33 (51%), Positives = 21/33 (63%) Frame = +2 Query: 104 ALKNALLELGSWQMLLTNLIYLQIHHRLTIPDT 202 A+K L + WQMLLT L L+ H+ LTI DT Sbjct: 11 AVKPCLSPVAVWQMLLTRL--LEQHYGLTINDT 41 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 124,262,417 Number of Sequences: 219361 Number of extensions: 2771840 Number of successful extensions: 6988 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6988 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 8466635400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)