| Clone Name | rbags39l06 |
|---|---|
| Clone Library Name | barley_pub |
>Y220_SILPO (Q5LX20) UPF0247 protein SPO0220| Length = 156 Score = 31.6 bits (70), Expect = 2.2 Identities = 26/66 (39%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = -3 Query: 644 LTRLFDETSKALGGAPAKKREIEDNSKK-IGALFAKLNTGDISPNVSSKLIQMCSALDSS 468 LTR FD T +ALG PA+ E+ED +GA A L + V L + L S Sbjct: 24 LTR-FDRTGRALGLGPARVVEVEDKKNAGMGAEAALLRKALPAGAVLCTLDERGKQLSSP 82 Query: 467 DFATAM 450 DFA M Sbjct: 83 DFADRM 88
>SRP54_YARLI (Q99150) Signal recognition particle 54 kDa protein homolog (SRP54)| Length = 536 Score = 30.4 bits (67), Expect = 4.9 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -3 Query: 581 IEDNSKKIGALFAKLNTG-DISPNVSSKLIQMCSALDSSD 465 +ED K+I FA L+ G DI + + L ++CSAL SD Sbjct: 3 LEDLGKRINGAFANLSKGGDIDEALDAMLKEVCSALLESD 42
>DMD_CAEEL (Q9TW65) Dystrophin-1| Length = 3674 Score = 30.4 bits (67), Expect = 4.9 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +3 Query: 102 PTTPPKDSHPLAKEHGKTIESSKRNVTRMTRPLSATRSSGRVDRRSR 242 P TPP H + GK+ E S R + S+++ SG+ + R Sbjct: 279 PQTPPTAHHQAMLDRGKSFEQSAEGEVRSRKSSSSSQKSGKSKKARR 325
>VGP_MABVP (P35254) Structural glycoprotein precursor (Virion spike| glycoprotein) Length = 681 Score = 30.0 bits (66), Expect = 6.5 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 2/71 (2%) Frame = +3 Query: 96 PKPTTPPKDSHPLAKEHGKTIESSKRNVTRMTR--PLSATRSSGRVDRRSRITSLCTPTL 269 P+P+TP ++ + G E +K N T P + T S ++ ++L ++ Sbjct: 300 PQPSTPQQEGNNTDHSQGTVTEPNKTNTTAQPSMPPHNTTAISTNNTSKNNFSTL---SV 356 Query: 270 QIANTNNFDNQ 302 + NT N+D Q Sbjct: 357 SLQNTTNYDTQ 367
>CCMA_VIBVY (Q7MIR0) Cytochrome c biogenesis ATP-binding export protein ccmA| (EC 3.6.3.41) (Heme exporter protein A) Length = 205 Score = 30.0 bits (66), Expect = 6.5 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +2 Query: 596 RVRLPRLWMSHQIVW 640 RV L RLW+SHQI+W Sbjct: 138 RVALARLWLSHQILW 152
>CCMA_VIBVU (Q8DB62) Cytochrome c biogenesis ATP-binding export protein ccmA| (EC 3.6.3.41) (Heme exporter protein A) Length = 205 Score = 30.0 bits (66), Expect = 6.5 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +2 Query: 596 RVRLPRLWMSHQIVW 640 RV L RLW+SHQI+W Sbjct: 138 RVALARLWLSHQILW 152
>PRELP_MOUSE (Q9JK53) Prolargin precursor (Proline-arginine-rich end| leucine-rich repeat protein) Length = 378 Score = 29.6 bits (65), Expect = 8.4 Identities = 18/53 (33%), Positives = 29/53 (54%) Frame = +1 Query: 22 LINSRVRKMDQLV*QTK*PLTTYNFQNQQHPQRTRILLQRNMEKLLSRQNVMS 180 L N+R+RK+DQ V K P + + + + L RN+E+L QN++S Sbjct: 129 LDNNRIRKVDQRV-LGKLPSLAFLYMEKNQLEEVPSALPRNLEQLRLSQNLIS 180
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 29.6 bits (65), Expect = 8.4 Identities = 22/63 (34%), Positives = 27/63 (42%) Frame = +3 Query: 75 TSYNL*FPKPTTPPKDSHPLAKEHGKTIESSKRNVTRMTRPLSATRSSGRVDRRSRITSL 254 TS L PKP P+ P +++ K K TRP S +RS R RSR S Sbjct: 241 TSDILKVPKPEPIPEPKEPSPEKNSK-----KEKEKEKTRPRSRSRSKSRSRTRSRSPSH 295 Query: 255 CTP 263 P Sbjct: 296 TRP 298
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 29.6 bits (65), Expect = 8.4 Identities = 22/63 (34%), Positives = 27/63 (42%) Frame = +3 Query: 75 TSYNL*FPKPTTPPKDSHPLAKEHGKTIESSKRNVTRMTRPLSATRSSGRVDRRSRITSL 254 TS L PKP P+ P +++ K K TRP S +RS R RSR S Sbjct: 241 TSDILKVPKPEPIPEPKEPSPEKNSK-----KEKEKEKTRPRSRSRSKSRSRTRSRSPSH 295 Query: 255 CTP 263 P Sbjct: 296 TRP 298 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,365,931 Number of Sequences: 219361 Number of extensions: 1824471 Number of successful extensions: 5073 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5071 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)