ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags39j15 |
|---|---|
| Clone Library Name | barley_pub |
>ZDH15_RAT (Q2TGJ4) Palmitoyltransferase ZDHHC15 (EC 2.3.1.-) (Zinc finger| DHHC domain-containing protein 15) (DHHC-15) Length = 337 Score = 34.7 bits (78), Expect = 0.25 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 6/85 (7%) Frame = +2 Query: 182 YKFVVRMTEFQLMLEHLLSVCRNHHCTSHWKTKRPSTRRKLNLKSETFTKCLYPAPLA-- 355 YKF ++ + ++ ++ + +W+ + PS R K ++ F C++ L Sbjct: 171 YKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVIL 230 Query: 356 ----CWLVSVNHTSG*LETIN*PVY 418 CWLVS N T+ LE PV+ Sbjct: 231 FGYHCWLVSRNKTT--LEAFCTPVF 253
>ZDH15_MOUSE (Q8BGJ0) Palmitoyltransferase ZDHHC15 (EC 2.3.1.-) (Zinc finger| DHHC domain-containing protein 15) (DHHC-15) Length = 337 Score = 34.7 bits (78), Expect = 0.25 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 6/85 (7%) Frame = +2 Query: 182 YKFVVRMTEFQLMLEHLLSVCRNHHCTSHWKTKRPSTRRKLNLKSETFTKCLYPAPLA-- 355 YKF ++ + ++ ++ + +W+ + PS R K ++ F C++ L Sbjct: 171 YKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVIL 230 Query: 356 ----CWLVSVNHTSG*LETIN*PVY 418 CWLVS N T+ LE PV+ Sbjct: 231 FGYHCWLVSRNKTT--LEAFCTPVF 253
>ZDH15_HUMAN (Q96MV8) Palmitoyltransferase ZDHHC15 (EC 2.3.1.-) (Zinc finger| DHHC domain-containing protein 15) (DHHC-15) Length = 337 Score = 34.7 bits (78), Expect = 0.25 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 6/85 (7%) Frame = +2 Query: 182 YKFVVRMTEFQLMLEHLLSVCRNHHCTSHWKTKRPSTRRKLNLKSETFTKCLYPAPLA-- 355 YKF ++ + ++ ++ + +W+ + PS R K ++ F C++ L Sbjct: 171 YKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVIL 230 Query: 356 ----CWLVSVNHTSG*LETIN*PVY 418 CWLVS N T+ LE PV+ Sbjct: 231 FGYHCWLVSRNKTT--LEAFCTPVF 253
>ZDHC2_HUMAN (Q9UIJ5) Palmitoyltransferase ZDHHC2 (EC 2.3.1.-) (Zinc finger DHHC| domain-containing protein 2) (DHHC-2) (Zinc finger protein 372) (Reduced expression associated with metastasis protein) (Ream) (Reduced expression in cancer protein) (Rec) Length = 367 Score = 30.4 bits (67), Expect = 4.8 Identities = 20/85 (23%), Positives = 35/85 (41%), Gaps = 6/85 (7%) Frame = +2 Query: 182 YKFVVRMTEFQLMLEHLLSVCRNHHCTSHWKTKRPSTRRKLNLKSETFTKCLYPAPLA-- 355 YKF + + L+ ++ + W P T+ K ++ F ++ L+ Sbjct: 169 YKFFLLFLAYSLLYCLFIAATDLQYFIKFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSL 228 Query: 356 ----CWLVSVNHTSG*LETIN*PVY 418 CWLVS N ++ LE PV+ Sbjct: 229 FGYHCWLVSKNKST--LEAFRSPVF 251
>COXX_BACSU (P24009) Protoheme IX farnesyltransferase (EC 2.5.1.-) (Heme O| synthase) Length = 305 Score = 30.0 bits (66), Expect = 6.3 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -3 Query: 187 LVYQGCCIILPIY-GNISLRVFPLLLFLTISFVTRDLVGFTSKNYL 53 +V+ C + LP + G++ L + L L L I ++ L+GF SKN + Sbjct: 233 IVWVACLMPLPFFLGSLGLPIVILGLLLNIGWLILGLMGFRSKNIM 278 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,868,816 Number of Sequences: 219361 Number of extensions: 2001920 Number of successful extensions: 3762 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3760 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
