| Clone Name | rbags39j14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FLA10_ARATH (Q9LZX4) Fasciclin-like arabinogalactan protein 10 p... | 36 | 0.11 | 2 | FLA8_ARATH (O22126) Fasciclin-like arabinogalactan protein 8 pre... | 34 | 0.33 | 3 | PPNK_TREPA (O83455) Probable inorganic polyphosphate/ATP-NAD kin... | 30 | 4.7 |
|---|
>FLA10_ARATH (Q9LZX4) Fasciclin-like arabinogalactan protein 10 precursor| Length = 422 Score = 35.8 bits (81), Expect = 0.11 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 646 DDTPVTVHTVDSVLLPPELFG 584 D+TPV + TVD+VLLP ELFG Sbjct: 314 DETPVVIFTVDNVLLPAELFG 334
>FLA8_ARATH (O22126) Fasciclin-like arabinogalactan protein 8 precursor| (AtAGP8) Length = 420 Score = 34.3 bits (77), Expect = 0.33 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 646 DDTPVTVHTVDSVLLPPELFG 584 D TPV + TVD+VLLP ELFG Sbjct: 313 DATPVVIFTVDNVLLPAELFG 333
>PPNK_TREPA (O83455) Probable inorganic polyphosphate/ATP-NAD kinase (EC| 2.7.1.23) (Poly(P)/ATP NAD kinase) Length = 305 Score = 30.4 bits (67), Expect = 4.7 Identities = 22/79 (27%), Positives = 31/79 (39%), Gaps = 10/79 (12%) Frame = -2 Query: 313 ALCRSRRRVTPLIRPS----------VRHRALVLFSSGHA*CDAPRSRL*VLEPLKCSSE 164 ALC S R P++ PS +RH+ VL GH C + CS+ Sbjct: 216 ALCLSNR---PVVVPSSGVVRIKVLSMRHKETVLSVDGHELCTLQEEDQLLASRSSCSAR 272 Query: 163 VVILLPGLDHLGDCDNLPW 107 +V P + + C L W Sbjct: 273 LVFCTPHVFYHALCSKLAW 291 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,769,376 Number of Sequences: 219361 Number of extensions: 923826 Number of successful extensions: 2453 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2453 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6086476506 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)