| Clone Name | rbags39g22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | WDR16_HUMAN (Q8N1V2) WD-repeat protein 16 (WD40-repeat protein u... | 30 | 5.4 |
|---|
>WDR16_HUMAN (Q8N1V2) WD-repeat protein 16 (WD40-repeat protein up-regulated in| HCC) Length = 620 Score = 30.4 bits (67), Expect = 5.4 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = -2 Query: 212 NLPNKRSWERDCIT--LFCFTHSAGLDIADVLFYLLLNVEYVLETTDSYSKLTSVG 51 +LPN++ W +C T L S G+D D FYL +L+ LT VG Sbjct: 188 DLPNRKIWPTECQTGQLKRIVMSIGVDDDDSFFYLGTTTGDILKMNPRTKLLTDVG 243 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,322,214 Number of Sequences: 219361 Number of extensions: 1910573 Number of successful extensions: 4151 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4040 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4150 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6912958834 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)