| Clone Name | rbags38p10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MDR10_ARATH (Q9SGY1) Multidrug resistance protein 10 (P-glycopro... | 28 | 4.9 | 2 | NUDH_HAEDU (Q7VPB7) Probable (di)nucleoside polyphosphate hydrol... | 28 | 6.4 | 3 | FLBA_EMENI (P38093) Developmental regulator flbA | 28 | 6.4 |
|---|
>MDR10_ARATH (Q9SGY1) Multidrug resistance protein 10 (P-glycoprotein 10)| Length = 1316 Score = 28.5 bits (62), Expect = 4.9 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = -1 Query: 203 DEELVVHVAKMKEGSVASATFCSG*NHSYAKDCMLLAVGTVXSCLYSVVVCRLYIRLG 30 D +V A KE S +F + + DC+L+A+G++ +C++ V +I G Sbjct: 6 DPAIVDMAAAEKEKKRPSVSFLKLFSFADFYDCVLMALGSIGACIHGASVPVFFIFFG 63
>NUDH_HAEDU (Q7VPB7) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 197 Score = 28.1 bits (61), Expect = 6.4 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -2 Query: 169 KKDRWLLLRSVADETIVMLKT 107 +K RW LL+ V+DE+ V LKT Sbjct: 96 QKQRWFLLQLVSDESAVNLKT 116
>FLBA_EMENI (P38093) Developmental regulator flbA| Length = 719 Score = 28.1 bits (61), Expect = 6.4 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +1 Query: 52 HTTTEYKHDXTVPTASSIQSLA*LWFHPLQNVAEATDPSFILATCTTNSSS 204 H K+D T + +I +L L F + + DPS I+ T TT + S Sbjct: 249 HRVRFTKYDHTFTSEEAINNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFS 299 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,803,628 Number of Sequences: 219361 Number of extensions: 505003 Number of successful extensions: 1122 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1122 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)