| Clone Name | rbags39e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LPXD_XANCP (Q8PAW3) UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a... | 30 | 6.9 | 2 | INSR_DROME (P09208) Insulin-like receptor precursor (EC 2.7.10.1... | 30 | 9.0 |
|---|
>LPXD_XANCP (Q8PAW3) UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase| (EC 2.3.1.-) Length = 337 Score = 30.0 bits (66), Expect = 6.9 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 6/77 (7%) Frame = +1 Query: 136 TTYVRVST-FEF*PMKQPKPEATAARDPLRSAREGSDLDALVA-----ERGHGCVVGAEE 297 T + +++ F+ P++ P A+A DP + + + V+ G GCV+GA Sbjct: 80 TAFAKIAALFDVAPVRAPGIHASAVIDPTATVSPTAHVGPFVSIGAGSRVGDGCVIGAGS 139 Query: 298 AVGRDEGEEDVADDRAE 348 + GE+ V DD E Sbjct: 140 II----GEDCVVDDGCE 152
>INSR_DROME (P09208) Insulin-like receptor precursor (EC 2.7.10.1) (DIR) (DInr)| (dIRH) [Contains: Insulin-like receptor alpha subunit; Insulin-like receptor beta 1 subunit; Insulin-like receptor beta 2 subunit] Length = 2144 Score = 29.6 bits (65), Expect = 9.0 Identities = 21/74 (28%), Positives = 37/74 (50%) Frame = -2 Query: 269 PRSATRASRSLPSRAERRGSLAAVASGFGCFMGQNSKVETRTYVVVSLCVCRRTK*SVRA 90 PR T+ S+S + + +AA A+ C +G V R +++ C CR+ +V + Sbjct: 5 PRGVTK-SKSKRGKIKMENDMAAAATTTACTLGHIC-VLCRQEMLLDTCCCRQAVEAVDS 62 Query: 89 HS*FQATYSASASS 48 + + YS+S SS Sbjct: 63 PASSEEAYSSSNSS 76 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,808,160 Number of Sequences: 219361 Number of extensions: 1343613 Number of successful extensions: 4217 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4031 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4212 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6769072002 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)