ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags39b20 |
|---|---|
| Clone Library Name | barley_pub |
>GRP8_ARATH (Q03251) Glycine-rich RNA-binding protein 8 (CCR1 protein)| Length = 169 Score = 35.0 bits (79), Expect = 0.12 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = -3 Query: 499 DHENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPKG 362 D E+G S+G ++ F DE + A+ E++G +L G + V EA+ +G Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQSRG 86
>NUCL_XENLA (P20397) Nucleolin (Protein C23)| Length = 650 Score = 35.0 bits (79), Expect = 0.12 Identities = 17/46 (36%), Positives = 32/46 (69%), Gaps = 1/46 (2%) Frame = -3 Query: 493 ENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPKGQ 359 ++G++KGIAY++F++E +KAL E G+++ G +++V K Q Sbjct: 356 KDGSNKGIAYVEFSNEDEANKALEEKQGAEIEGRSIFVDFTGEKSQ 401 Score = 31.2 bits (69), Expect = 1.7 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -3 Query: 499 DHENGASKGIAYMDFTDESSFSKALE-LSGSDLGGCNLYVAEAKPKG 362 D + GASKG ++DF+ A E + ++ G + + AKPKG Sbjct: 533 DRDTGASKGFGFVDFSTAEDAKAAKEAMEDGEIDGNKVTLDFAKPKG 579 Score = 31.2 bits (69), Expect = 1.7 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 487 GASKGIAYMDFTDESSFSKALELSGSDLGGCNLYVAEA 374 G SK Y+DF+ E KAL+L+G + G + + +A Sbjct: 269 GNSKKFGYVDFSSEEEVEKALKLTGKKILGTEVKIEKA 306
>PABPA_XENLA (P20965) Polyadenylate-binding protein 1-A (Poly(A)-binding protein| 1-A) (Cytoplasmic poly(A)-binding protein 1-A) (PABP-A) (PABP 1-A) (xPABP1-A) Length = 633 Score = 34.7 bits (78), Expect = 0.16 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -3 Query: 502 MDHENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPK 365 M +NG SKG ++ F KA+ E++G D+ G +++V A+ K Sbjct: 223 MTDDNGKSKGFGFVSFERHEDAQKAVDEMNGKDMNGKSMFVGRAQKK 269
>NUCL_HUMAN (P19338) Nucleolin (Protein C23)| Length = 709 Score = 34.3 bits (77), Expect = 0.20 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -3 Query: 499 DHENGASKGIAYMDFTDESSFSKALE-LSGSDLGGCNLYVAEAKPKGQ 359 D E G+SKG ++DF E A E + ++ G + + AKPKG+ Sbjct: 602 DRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGE 649 Score = 30.8 bits (68), Expect = 2.3 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -3 Query: 493 ENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPKGQ 359 ++G SKGIAY++F E+ K E G+++ G ++ + KGQ Sbjct: 423 KDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQ 468 Score = 28.9 bits (63), Expect = 8.6 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -3 Query: 502 MDHENGASKGIAYMDFTDESSFSKALELSGSDLGGCNLYVAEAKPKGQ 359 +D G ++ Y+DF KALEL+G + G + + KPKG+ Sbjct: 338 VDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKL--EKPKGK 383
>NUCL_MOUSE (P09405) Nucleolin (Protein C23)| Length = 706 Score = 34.3 bits (77), Expect = 0.20 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -3 Query: 499 DHENGASKGIAYMDFTDESSFSKALE-LSGSDLGGCNLYVAEAKPKGQ 359 D E G+SKG ++DF E A E + ++ G + + AKPKG+ Sbjct: 599 DRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGE 646 Score = 32.0 bits (71), Expect = 1.0 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -3 Query: 493 ENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPKGQ 359 ++G SKGIAY++F E+ K L E G+++ G ++ + KGQ Sbjct: 425 QDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQ 470 Score = 30.4 bits (67), Expect = 3.0 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -3 Query: 502 MDHENGASKGIAYMDFTDESSFSKALELSGSDLGGCNLYVAEAKPKGQ 359 +D G ++ Y+DF KALEL+G + G + + KPKG+ Sbjct: 340 VDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKL--EKPKGR 385
>NUCL_MESAU (P08199) Nucleolin (Protein C23)| Length = 713 Score = 34.3 bits (77), Expect = 0.20 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -3 Query: 499 DHENGASKGIAYMDFTDESSFSKALE-LSGSDLGGCNLYVAEAKPKGQ 359 D E G+SKG ++DF E A E + ++ G + + AKPKG+ Sbjct: 602 DRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGE 649 Score = 32.0 bits (71), Expect = 1.0 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -3 Query: 493 ENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPKGQ 359 ++G SKGIAY++F E+ K L E G+++ G ++ + KGQ Sbjct: 424 QDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQ 469 Score = 30.4 bits (67), Expect = 3.0 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -3 Query: 502 MDHENGASKGIAYMDFTDESSFSKALELSGSDLGGCNLYVAEAKPKGQ 359 +D G ++ Y+DF KALEL+G + G + + KPKG+ Sbjct: 339 VDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKL--EKPKGR 384
>PABP3_HUMAN (Q9H361) Polyadenylate-binding protein 3 (Poly(A)-binding protein| 3) (PABP 3) (Testis-specific poly(A)-binding protein) Length = 631 Score = 34.3 bits (77), Expect = 0.20 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 502 MDHENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPK 365 M E+G SKG ++ F KA+ E++G +L G +YV A+ K Sbjct: 223 MTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKK 269
>PABP1_RAT (Q9EPH8) Polyadenylate-binding protein 1 (Poly(A)-binding protein| 1) (PABP 1) Length = 636 Score = 34.3 bits (77), Expect = 0.20 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 502 MDHENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPK 365 M E+G SKG ++ F KA+ E++G +L G +YV A+ K Sbjct: 223 MTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKK 269
>PABP1_MOUSE (P29341) Polyadenylate-binding protein 1 (Poly(A)-binding protein| 1) (PABP 1) Length = 636 Score = 34.3 bits (77), Expect = 0.20 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 502 MDHENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPK 365 M E+G SKG ++ F KA+ E++G +L G +YV A+ K Sbjct: 223 MTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKK 269
>PABP1_HUMAN (P11940) Polyadenylate-binding protein 1 (Poly(A)-binding protein| 1) (PABP 1) Length = 636 Score = 34.3 bits (77), Expect = 0.20 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 502 MDHENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPK 365 M E+G SKG ++ F KA+ E++G +L G +YV A+ K Sbjct: 223 MTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKK 269
>PABP1_BOVIN (P61286) Polyadenylate-binding protein 1 (Poly(A)-binding protein| 1) (PABP 1) Length = 636 Score = 34.3 bits (77), Expect = 0.20 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 502 MDHENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPK 365 M E+G SKG ++ F KA+ E++G +L G +YV A+ K Sbjct: 223 MTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKK 269
>NUCL_RAT (P13383) Nucleolin (Protein C23)| Length = 712 Score = 34.3 bits (77), Expect = 0.20 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -3 Query: 499 DHENGASKGIAYMDFTDESSFSKALE-LSGSDLGGCNLYVAEAKPKGQ 359 D E G+SKG ++DF E A E + ++ G + + AKPKG+ Sbjct: 605 DRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGE 652 Score = 32.0 bits (71), Expect = 1.0 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -3 Query: 493 ENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPKGQ 359 ++G SKGIAY++F E+ K L E G+++ G ++ + KGQ Sbjct: 427 QDGRSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQ 472 Score = 30.4 bits (67), Expect = 3.0 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -3 Query: 502 MDHENGASKGIAYMDFTDESSFSKALELSGSDLGGCNLYVAEAKPKGQ 359 +D G ++ Y+DF KALEL+G + G + + KPKG+ Sbjct: 342 VDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKL--EKPKGR 387
>NUCL_MACFA (Q4R4J7) Nucleolin| Length = 710 Score = 34.3 bits (77), Expect = 0.20 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -3 Query: 499 DHENGASKGIAYMDFTDESSFSKALE-LSGSDLGGCNLYVAEAKPKGQ 359 D E G+SKG ++DF E A E + ++ G + + AKPKG+ Sbjct: 603 DRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGE 650 Score = 30.8 bits (68), Expect = 2.3 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -3 Query: 493 ENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPKGQ 359 ++G SKGIAY++F E+ K E G+++ G ++ + KGQ Sbjct: 424 KDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQ 469 Score = 28.9 bits (63), Expect = 8.6 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -3 Query: 502 MDHENGASKGIAYMDFTDESSFSKALELSGSDLGGCNLYVAEAKPKGQ 359 +D G ++ Y+DF KALEL+G + G + + KPKG+ Sbjct: 339 VDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKL--EKPKGK 384
>NUCL_CHICK (P15771) Nucleolin (Protein C23)| Length = 694 Score = 34.3 bits (77), Expect = 0.20 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -3 Query: 487 GASKGIAYMDFTDESSFSKALELSGSDLGGCNLYVAEAKPK 365 G+SK Y+DF KAL+L+G L G + + +AK K Sbjct: 318 GSSKRFGYVDFLSAEDMDKALQLNGKKLMGLEIKLEKAKSK 358 Score = 31.2 bits (69), Expect = 1.7 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -3 Query: 499 DHENGASKGIAYMDFTDESSFSKALE-LSGSDLGGCNLYVAEAKPKGQ 359 D + G+SKG ++DF+ A E + ++ G + + AKPKG+ Sbjct: 584 DRDTGSSKGFGFVDFSSPEDAKAAKEAMEDGEIDGNKVTLDFAKPKGE 631 Score = 30.8 bits (68), Expect = 2.3 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = -3 Query: 496 HENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPKGQ 359 ++ G+SKG+AY++F E+ KAL E G+++ G + + K Q Sbjct: 402 NKEGSSKGMAYIEFKTEAEAEKALEEKQGTEVDGRAMVIDYTGEKSQ 448
>NUCL_PONPY (Q5RF26) Nucleolin| Length = 711 Score = 34.3 bits (77), Expect = 0.20 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -3 Query: 499 DHENGASKGIAYMDFTDESSFSKALE-LSGSDLGGCNLYVAEAKPKGQ 359 D E G+SKG ++DF E A E + ++ G + + AKPKG+ Sbjct: 604 DRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGE 651 Score = 30.8 bits (68), Expect = 2.3 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -3 Query: 493 ENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPKGQ 359 ++G SKGIAY++F E+ K E G+++ G ++ + KGQ Sbjct: 425 KDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQ 470 Score = 28.9 bits (63), Expect = 8.6 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -3 Query: 502 MDHENGASKGIAYMDFTDESSFSKALELSGSDLGGCNLYVAEAKPKGQ 359 +D G ++ Y+DF KALEL+G + G + + KPKG+ Sbjct: 340 VDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKL--EKPKGK 385
>RSD1_SCHPO (O13845) RNA-binding protein rsd1| Length = 604 Score = 33.5 bits (75), Expect = 0.35 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = -3 Query: 499 DHENGASKGIAYMDFTDESSFSKALELSGSDLGGCNLYV 383 D +G SKG+AY++F E S A+ LSG L G + V Sbjct: 274 DKISGRSKGVAYVEFCHEDSVQAAIALSGKRLLGLPVIV 312
>GRP2_ARATH (Q9SVM8) Glycine-rich RNA-binding protein 2, mitochondrial| precursor (AtGRP2) Length = 158 Score = 33.1 bits (74), Expect = 0.46 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = -3 Query: 508 VPMDHENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPK 365 V +D E G S+G +++F DE + + A+ E+ G +L G ++ V A + Sbjct: 66 VIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPANDR 114
>RNPC2_MOUSE (Q8VH51) RNA-binding region-containing protein 2 (Coactivator of| activating protein 1 and estrogen receptors) (Coactivator of AP-1 and ERs) (Transcription coactivator CAPER) Length = 530 Score = 33.1 bits (74), Expect = 0.46 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -3 Query: 502 MDHENGASKGIAYMDFTDESSFSKALE-LSGSDLGG 398 MD E G SKG ++ F+D KALE L+G +L G Sbjct: 283 MDSETGRSKGYGFITFSDSECAKKALEQLNGFELAG 318 Score = 30.0 bits (66), Expect = 3.9 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -3 Query: 499 DHENGASKGIAYMDFTDESSFSKALELSGSDLGGCNLYV 383 D + S+GIAY++F D SS A+ L+G + G + V Sbjct: 187 DRNSRRSRGIAYVEFVDVSSVRLAIGLTGQRVLGVPIIV 225
>RNPC2_HUMAN (Q14498) RNA-binding region-containing protein 2 (Hepatocellular| carcinoma protein 1) (Splicing factor HCC1) Length = 530 Score = 33.1 bits (74), Expect = 0.46 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -3 Query: 502 MDHENGASKGIAYMDFTDESSFSKALE-LSGSDLGG 398 MD E G SKG ++ F+D KALE L+G +L G Sbjct: 283 MDSETGRSKGYGFITFSDSECAKKALEQLNGFELAG 318 Score = 31.2 bits (69), Expect = 1.7 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -3 Query: 499 DHENGASKGIAYMDFTDESSFSKALELSGSDLGGCNLYV 383 D + SKGIAY++F D SS A+ L+G + G + V Sbjct: 187 DRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIV 225
>PABP_YEAST (P04147) Polyadenylate-binding protein, cytoplasmic and nuclear| (Poly(A)-binding protein) (PABP) (ARS consensus-binding protein ACBP-67) (Polyadenylate tail-binding protein) Length = 576 Score = 32.3 bits (72), Expect = 0.78 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = -3 Query: 493 ENGASKGIAYMDFTDESSFSKALE-LSGSDLGGCNLYVA 380 ENG SKG ++ F +E + +A++ L+G L G +YVA Sbjct: 160 ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVA 198
>SCE3_SCHPO (O14369) Probable RNA-binding protein sce3| Length = 388 Score = 32.3 bits (72), Expect = 0.78 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -3 Query: 481 SKGIAYMDFTDESSFSKALELSGSDLGGCNLYVAEAKPK 365 S+G Y++F + S AL LSG DL G + + A+P+ Sbjct: 132 SRGFGYVEFETADTLSAALALSGEDLMGRPVRITVAEPR 170
>GAR2_SCHPO (P41891) Protein gar2| Length = 500 Score = 32.0 bits (71), Expect = 1.0 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -3 Query: 508 VPMDHENGASKGIAYMDFTDESSFSKALELSGSDLGG 398 +P D ++G KG Y+ F+D S K +E++G + G Sbjct: 397 LPTDPQSGRLKGFGYVTFSDIDSAKKCVEMNGHFIAG 433
>MRD1_SCHPO (O13620) Multiple RNA-binding domain-containing protein 1| Length = 833 Score = 30.8 bits (68), Expect = 2.3 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -3 Query: 508 VPMDHENGASKGIAYMDFTDESSFSKA-LELSGSDLGGCNLYVAEAKPK 365 +P+D + KG AY+DF D +A LEL G L+V AK + Sbjct: 354 MPIDKKTNNPKGFAYIDFHDADDAVRAYLELDAKPFQGRLLHVLPAKAR 402
>RNP24_SCHPO (Q09100) RNA-binding protein rnp24| Length = 369 Score = 30.4 bits (67), Expect = 3.0 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -3 Query: 508 VPMDHENG-ASKGIAYMDFTDESSFSKALELSGSDLGGCNLYV 383 +PM E +KG AY+DF E + AL+ S L G N+ + Sbjct: 154 MPMSKEKRFQNKGFAYVDFATEDALKLALQCSEKALNGRNILI 196
>YQO4_CAEEL (Q09295) Putative RNA-binding protein EEED8.4| Length = 237 Score = 30.0 bits (66), Expect = 3.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 511 SVPMDHENGASKGIAYMDFTDESSFSKALELSGS 410 ++P D K AY++F D SS AL ++GS Sbjct: 131 TIPKDKFTKKQKNFAYIEFDDSSSIENALVMNGS 164
>YQOC_CAEEL (Q09301) Putative RNA-binding protein EEED8.12| Length = 197 Score = 30.0 bits (66), Expect = 3.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 511 SVPMDHENGASKGIAYMDFTDESSFSKALELSGS 410 ++P D K AY++F D SS AL ++GS Sbjct: 91 TIPKDKFTKKQKNFAYIEFDDSSSIENALVMNGS 124
>PABP4_HUMAN (Q13310) Polyadenylate-binding protein 4 (Poly(A)-binding protein| 4) (PABP 4) (Inducible poly(A)-binding protein) (iPABP) (Activated-platelet protein 1) (APP-1) Length = 644 Score = 30.0 bits (66), Expect = 3.9 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = -3 Query: 493 ENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYVAEAKPK 365 E+G SKG ++ F+ +KA+ E++G +G LYVA A+ K Sbjct: 328 EDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRK 371
>ROC3_NICSY (P19682) 28 kDa ribonucleoprotein, chloroplast precursor (28RNP)| Length = 276 Score = 29.6 bits (65), Expect = 5.0 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = -3 Query: 508 VPMDHENGASKGIAYMDFTDESSFSKAL-ELSGSDLGGCNLYV--AEAKPK 365 V D E+G S+G ++ + E+ S+A+ L G L G + V AE +P+ Sbjct: 222 VVFDRESGRSRGFGFVTMSSEAEMSEAIANLDGQTLDGRTIRVNAAEERPR 272
>FGD5_HUMAN (Q6ZNL6) FYVE, RhoGEF and PH domain-containing protein 5 (Zinc finger| FYVE domain-containing protein 23) Length = 1462 Score = 29.3 bits (64), Expect = 6.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 105 LSHKMVCCNCRVSGRLYLRVFHCPSGPSIIC 13 ++H M+C NC L LR HC + I+C Sbjct: 1242 VTHVMMCMNCGCDFSLTLRRHHCHACGKIVC 1272 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,412,217 Number of Sequences: 219361 Number of extensions: 651397 Number of successful extensions: 2255 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 2151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2244 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
