| Clone Name | rbags38m18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y173_UREPA (Q9PQX0) Hypothetical protein UU173 | 32 | 2.1 | 2 | EFG_STRT2 (Q5M2M6) Elongation factor G (EF-G) | 30 | 8.0 | 3 | EFG_STRT1 (Q5LY21) Elongation factor G (EF-G) | 30 | 8.0 |
|---|
>Y173_UREPA (Q9PQX0) Hypothetical protein UU173| Length = 690 Score = 32.0 bits (71), Expect = 2.1 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +1 Query: 115 VIS*LSTYTTDLFQIIIQHNFPPTYINARHMYRDKHDMNDNDYWL 249 VIS L + +L + I+ P +I + Y DK D DND+WL Sbjct: 347 VISELLVHKQNLLALPIEQRIPNYFIPS---YNDKGDYKDNDFWL 388
>EFG_STRT2 (Q5M2M6) Elongation factor G (EF-G)| Length = 693 Score = 30.0 bits (66), Expect = 8.0 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Frame = +1 Query: 136 YTTDLFQIIIQHNFPPTYINARHMYRDK----HDMNDNDYWLTYLSSKEI 273 YT DL I++ + P Y++ + YR+K D D + YL +EI Sbjct: 186 YTNDLGTDILEEDIPAEYVDQANEYREKLIEAVAETDEDLMMKYLEGEEI 235
>EFG_STRT1 (Q5LY21) Elongation factor G (EF-G)| Length = 693 Score = 30.0 bits (66), Expect = 8.0 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Frame = +1 Query: 136 YTTDLFQIIIQHNFPPTYINARHMYRDK----HDMNDNDYWLTYLSSKEI 273 YT DL I++ + P Y++ + YR+K D D + YL +EI Sbjct: 186 YTNDLGTDILEEDIPAEYVDQANEYREKLIEAVAETDEDLMMKYLEGEEI 235 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 109,440,034 Number of Sequences: 219361 Number of extensions: 2234857 Number of successful extensions: 4305 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4206 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4305 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7932903580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)