ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal2g09 |
|---|---|
| Clone Library Name | barley_pub |
>ATKA_PSESM (Q883V6) Potassium-transporting ATPase A chain (EC 3.6.3.12)| (Potassium-translocating ATPase A chain) (ATP phosphohydrolase [potassium-transporting] A chain) (Potassium-binding and translocating subunit A) Length = 564 Score = 31.2 bits (69), Expect = 2.3 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +3 Query: 399 TPKFLGRLLFTLSIRLVXATGLVVPYVLLAISACDAHL 512 TP++LG+ L +RL+ AT LV+P +L + A A L Sbjct: 405 TPEYLGKKLQAQEVRLLVATLLVMPVGVLVLGAIAASL 442
>CTF1_SCHPO (O43040) Cleavage and termination factor 1 (Transcription| termination factor ctf1) Length = 363 Score = 30.4 bits (67), Expect = 4.0 Identities = 20/72 (27%), Positives = 35/72 (48%) Frame = +3 Query: 60 KEKKNKSMYTSGNTXHSSKSIKLNLYNLQIARTRKRKRITH*VLVKDLSQVQYWEREKNG 239 K +NK YTSG + + SI L +Q+ T + + + ++ L V + E+ Sbjct: 192 KSSQNKGDYTSGTSISNPTSIPLAPSVVQVLSTFSAQELLN--MLSKLQTVVHIAPEEAR 249 Query: 240 HLLTDSPKIPYS 275 LL +P +PY+ Sbjct: 250 RLLIANPALPYA 261
>ATKA_THETN (Q8R8I5) Potassium-transporting ATPase A chain (EC 3.6.3.12)| (Potassium-translocating ATPase A chain) (ATP phosphohydrolase [potassium-transporting] A chain) (Potassium-binding and translocating subunit A) Length = 561 Score = 30.4 bits (67), Expect = 4.0 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +3 Query: 399 TPKFLGRLLFTLSIRLVXATGLVVPYVLLAISACDAHLR 515 TP++LGR + T I+L+ LV P+++L SA L+ Sbjct: 403 TPEYLGRKIETKEIKLIALAILVHPFLILFSSALTVMLK 441
>RSMB_HAEDU (Q7VKC4) Ribosomal RNA small subunit methyltransferase B (EC| 2.1.1.-) (rRNA (cytosine-C(5)-)-methyltransferase) (16S rRNA m5C967 methyltransferase) Length = 435 Score = 30.0 bits (66), Expect = 5.2 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 4/53 (7%) Frame = -2 Query: 548 GGKNWHVVQQIPEVRITSTDGKK----YIRYNKARRXYETNAQCEEKST*KFW 402 GGK H+++Q P+ ++ + D ++ +R N AR + +C + +T W Sbjct: 259 GGKTTHILEQAPQAKVIALDIEESRLVRVRENLARLGLTADVRCGDATTPTKW 311
>GABR1_MOUSE (Q9WV18) Gamma-aminobutyric acid type B receptor, subunit 1| precursor (GABA-B receptor 1) (GABA-B-R1) (Gb1) Length = 960 Score = 29.6 bits (65), Expect = 6.7 Identities = 23/76 (30%), Positives = 41/76 (53%) Frame = +3 Query: 330 KTRHLLEQSGRADQNMSTKQLPNTPKFLGRLLFTLSIRLVXATGLVVPYVLLAISACDAH 509 KT + S ADQ + K T +FL + LF +S+ ++ + G+V+ V L+ + ++H Sbjct: 563 KTDKWIGGSPPADQTLVIK----TFRFLSQKLF-ISVSVLSSLGIVLAVVCLSFNIYNSH 617 Query: 510 LRDLLYNVPVLPALQA 557 +R + + P L L A Sbjct: 618 VRYIQNSQPNLNNLTA 633
>GABR1_RAT (Q9Z0U4) Gamma-aminobutyric acid type B receptor, subunit 1| precursor (GABA-B receptor 1) (GABA-B-R1) (Gb1) Length = 991 Score = 29.6 bits (65), Expect = 6.7 Identities = 23/76 (30%), Positives = 41/76 (53%) Frame = +3 Query: 330 KTRHLLEQSGRADQNMSTKQLPNTPKFLGRLLFTLSIRLVXATGLVVPYVLLAISACDAH 509 KT + S ADQ + K T +FL + LF +S+ ++ + G+V+ V L+ + ++H Sbjct: 563 KTDKWIGGSPPADQTLVIK----TFRFLSQKLF-ISVSVLSSLGIVLAVVCLSFNIYNSH 617 Query: 510 LRDLLYNVPVLPALQA 557 +R + + P L L A Sbjct: 618 VRYIQNSQPNLNNLTA 633
>ATKA_PSEPK (Q88FD7) Potassium-transporting ATPase A chain (EC 3.6.3.12)| (Potassium-translocating ATPase A chain) (ATP phosphohydrolase [potassium-transporting] A chain) (Potassium-binding and translocating subunit A) Length = 564 Score = 29.6 bits (65), Expect = 6.7 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 399 TPKFLGRLLFTLSIRLVXATGLVVPYVLLAISACDAHL 512 TP++LG+ L ++L+ AT LV+P +L + A A L Sbjct: 405 TPEYLGKKLQAREVQLLVATLLVMPVGVLVLGAIAASL 442
>GABR1_HUMAN (Q9UBS5) Gamma-aminobutyric acid type B receptor, subunit 1| precursor (GABA-B receptor 1) (GABA-B-R1) (Gb1) Length = 961 Score = 29.6 bits (65), Expect = 6.7 Identities = 23/76 (30%), Positives = 41/76 (53%) Frame = +3 Query: 330 KTRHLLEQSGRADQNMSTKQLPNTPKFLGRLLFTLSIRLVXATGLVVPYVLLAISACDAH 509 KT + S ADQ + K T +FL + LF +S+ ++ + G+V+ V L+ + ++H Sbjct: 564 KTDKWIGGSPPADQTLVIK----TFRFLSQKLF-ISVSVLSSLGIVLAVVCLSFNIYNSH 618 Query: 510 LRDLLYNVPVLPALQA 557 +R + + P L L A Sbjct: 619 VRYIQNSQPNLNNLTA 634
>CP2J2_HUMAN (P51589) Cytochrome P450 2J2 (EC 1.14.14.1) (CYPIIJ2) (Arachidonic| acid epoxygenase) Length = 502 Score = 29.6 bits (65), Expect = 6.7 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = +3 Query: 189 LVKDLSQVQYWEREKNGHLLTDSPKIPYSFHGPHQTISSN 308 L+K L +V Y E K L P I GPHQT+ SN Sbjct: 211 LLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGPHQTLFSN 250
>ATKA_CHRVO (Q7NXM7) Potassium-transporting ATPase A chain (EC 3.6.3.12)| (Potassium-translocating ATPase A chain) (ATP phosphohydrolase [potassium-transporting] A chain) (Potassium-binding and translocating subunit A) Length = 602 Score = 29.3 bits (64), Expect = 8.8 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = +3 Query: 399 TPKFLGRLLFTLSIRLVXATGLVVPYVLLAISA 497 TP++LG+ + T +++ T LV P ++LA++A Sbjct: 441 TPEYLGKKIETYEMKMTAITILVTPTLVLALTA 473
>NR2F5_BRARE (Q06726) Nuclear receptor Nr2f5 (Steroid receptor homolog SVP 46)| Length = 403 Score = 29.3 bits (64), Expect = 8.8 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 8/80 (10%) Frame = +3 Query: 348 EQSGRADQNMSTKQLPNTPKFLGRLLFTL-SIRLVXATGLVVPYV--LLAISACDAHLRD 518 E+S A + Q PN P GRLL L S+R+V + + + L+ + + LRD Sbjct: 314 EKSQCALEEYVRNQYPNQPNRFGRLLLRLPSLRIVSSPVIEQLFFVRLVGKTPIETLLRD 373 Query: 519 LL-----YNVPVLPALQAAP 563 +L YN P +P + P Sbjct: 374 MLLSGSSYNWPYMPVQRDRP 393 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,262,433 Number of Sequences: 219361 Number of extensions: 1877733 Number of successful extensions: 4817 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 4630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4816 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5101629520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
