| Clone Name | rbags39b10 |
|---|---|
| Clone Library Name | barley_pub |
>G6PT1_HUMAN (O43826) Glucose-6-phosphate translocase (Glucose-5-phosphate| transporter) (Solute carrier family 37 member 4) Length = 429 Score = 30.0 bits (66), Expect = 4.0 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -3 Query: 321 GFGPVFAAIICSSYSWQR--AVAGHLVVIL 238 G GP+ A I+ SYSW+ A++G L V++ Sbjct: 150 GLGPILATILAQSYSWRSTLALSGALCVVV 179
>ALKBH_ARATH (Q9SA98) Alkylated DNA repair protein alkB homolog| Length = 354 Score = 29.6 bits (65), Expect = 5.3 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +2 Query: 335 SSCP*NSLSLIKIGILRQIGWKYLSLEFDWHSARNY 442 SSC S S++ LR++ W L L+FDW S RNY Sbjct: 163 SSCKSVSASVL----LRKLRWSTLGLQFDW-SKRNY 193
>NOTC4_HUMAN (Q99466) Neurogenic locus notch homolog protein 4 precursor (Notch| 4) (hNotch4) [Contains: Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 2003 Score = 29.3 bits (64), Expect = 6.9 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 272 CHE*LEQIMAANTGPNPFNHESSC 343 CH+ L++ + A GP+P H SC Sbjct: 429 CHQDLDECLMAQQGPSPCEHGGSC 452
>SYP_CLOST (Q9L4Q8) Prolyl-tRNA synthetase (EC 6.1.1.15) (Proline--tRNA| ligase) (ProRS) Length = 481 Score = 28.9 bits (63), Expect = 9.0 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -3 Query: 312 PVFAAIICSSYS-WQRAVAGHLVVILKPQPVIRWQAKEVPYVRIVHWLWLE 163 P IICS YS W + + + V+RW+ P++R +LW E Sbjct: 115 PTSETIICSMYSKWLTSYRELPYLYNQWCSVVRWEKSTRPFLRTSEFLWQE 165
>MATK_RHISY (Q9GFN8) Maturase K (Intron maturase)| Length = 505 Score = 28.9 bits (63), Expect = 9.0 Identities = 19/85 (22%), Positives = 40/85 (47%), Gaps = 5/85 (5%) Frame = -3 Query: 351 FQGQLLS*LNGFGPVFAAIIC---SSYSWQRAVAGHLVVILKPQPVI--RWQAKEVPYVR 187 F G+L + F F +++C + G L++ K P++ +W+ V + Sbjct: 246 FYGKLEQFTDVFANDFPSVLCLFKDPFMHYVRYQGKLILASKYTPLLMKKWKYYLVNLGQ 305 Query: 186 IVHWLWLEPQLTFMVVLVRHMLSFL 112 ++W +P+ ++ +L +H L FL Sbjct: 306 CHFYVWFQPEKIYINLLSKHSLDFL 330
>DPO4_CLOAB (Q97MB3) DNA polymerase IV (EC 2.7.7.7) (Pol IV)| Length = 396 Score = 28.9 bits (63), Expect = 9.0 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +1 Query: 406 VSRIRLALCEKLCQTLDDANKWTTASAV 489 + +I + LCE L Q L DANK+ T+ +V Sbjct: 267 IHKILVTLCENLGQRLRDANKYCTSISV 294
>POLS_EEVVM (P36331) Structural polyprotein (p130) [Contains: Capsid protein| (EC 3.4.21.-) (Coat protein) (C); p62 (E3/E2); E3 protein (Spike glycoprotein E3); E2 envelope glycoprotein (Spike glycoprotein E2); 6K protein; E1 envelope glycoprotein (Spike g Length = 1254 Score = 28.9 bits (63), Expect = 9.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 200 TSFACHLITGWGFRITTRCPA 262 TS CH+I G G+ + RCPA Sbjct: 419 TSRPCHIIDGHGYFLLARCPA 439 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,334,773 Number of Sequences: 219361 Number of extensions: 1516810 Number of successful extensions: 3777 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3777 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)