| Clone Name | rbaal2g07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CEND1_HUMAN (Q8WZ64) Centaurin-delta 1 (Cnt-d1) (Arf-GAP, Rho-GA... | 28 | 5.9 |
|---|
>CEND1_HUMAN (Q8WZ64) Centaurin-delta 1 (Cnt-d1) (Arf-GAP, Rho-GAP, ankyrin| repeat and pleckstrin homology domain-containing protein 2) (PARX protein) Length = 1704 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 80 LYNVIHRKNAENLPHMDAFIPSPQKKTCIEXSNA 181 +Y +H+ + P D +PS + CIE SN+ Sbjct: 76 IYANVHKTKKNDDPSKDYHVPSSDQNICIELSNS 109 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,673,676 Number of Sequences: 219361 Number of extensions: 571486 Number of successful extensions: 920 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 920 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)