| Clone Name | rbags39a14 |
|---|---|
| Clone Library Name | barley_pub |
>YFGH_ECOLI (P65290) Hypothetical lipoprotein yfgH precursor| Length = 172 Score = 32.3 bits (72), Expect = 1.1 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = -3 Query: 411 IGSLGNIGKTFGAACSMIGGKKLGNMHDALSNTRT--DGIGALIREGAAAYLNSIVNNKF 238 +GS N G T GA +GG +G ++ N +T +G+ +EG Y ++ V + Sbjct: 88 VGSGSNSGTTAGA----VGGGAVGAAAGSMVNDKTLVEGVSLTYKEGTKVYTSTQVGKEC 143 Query: 237 PFTT 226 FTT Sbjct: 144 QFTT 147
>YFGH_ECO57 (P65291) Hypothetical lipoprotein yfgH precursor| Length = 172 Score = 32.3 bits (72), Expect = 1.1 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = -3 Query: 411 IGSLGNIGKTFGAACSMIGGKKLGNMHDALSNTRT--DGIGALIREGAAAYLNSIVNNKF 238 +GS N G T GA +GG +G ++ N +T +G+ +EG Y ++ V + Sbjct: 88 VGSGSNSGTTAGA----VGGGAVGAAAGSMVNDKTLVEGVSLTYKEGTKVYTSTQVGKEC 143 Query: 237 PFTT 226 FTT Sbjct: 144 QFTT 147
>ELTD1_MOUSE (Q923X1) EGF, latrophilin seven transmembrane domain-containing| protein 1 precursor Length = 739 Score = 30.0 bits (66), Expect = 5.3 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +1 Query: 247 VHNGVEVCSCPLAYQGAN-TISSSV*EC 327 VHNGVE C C Y G TI + EC Sbjct: 35 VHNGVEACFCSQGYSGNGVTICEDIDEC 62
>ACDB1_METJA (Q57616) Acetyl-CoA decarbonylase/synthase complex beta subunit 1| (EC 2.3.1.-) (ACDS complex beta subunit 1) (ACDS complex acyltransferase 1) Length = 748 Score = 29.6 bits (65), Expect = 6.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 450 DFWKNHPDAIIAAIGSLGNIGKTFGAACSMIG 355 D+ KN A++ A+G L NI GA C G Sbjct: 224 DYLKNRVPAVVVALGELDNITLAAGAGCIKAG 255
>NOTC2_RAT (Q9QW30) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 29.3 bits (64), Expect = 9.0 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 253 NGVEVCSCPLAYQGANTISSSV*ECIM 333 NG +C+CP AY+GA+ + V EC M Sbjct: 396 NGQYICTCPQAYKGAD-CTEDVDECAM 421 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,638,179 Number of Sequences: 219361 Number of extensions: 1578808 Number of successful extensions: 4251 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4251 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)