| Clone Name | rbags38l11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VMSA_HBVW9 (P17101) Major surface antigen precursor | 35 | 0.33 | 2 | REM1_SCHPO (O14332) Meiosis-specific cyclin rem1 | 31 | 3.7 | 3 | PAX8_RAT (P51974) Paired box protein Pax-8 | 30 | 6.3 |
|---|
>VMSA_HBVW9 (P17101) Major surface antigen precursor| Length = 399 Score = 34.7 bits (78), Expect = 0.33 Identities = 26/75 (34%), Positives = 35/75 (46%), Gaps = 12/75 (16%) Frame = -3 Query: 689 PATARKQEGLNTSASSPP--DSDNEVHSSNSEGFHGFLQD--------LAGGDTPG--NP 546 PA+A +Q G + SPP DS + NS FH LQD AGG + G NP Sbjct: 93 PASANRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNP 152 Query: 545 CADDAKAMEELCARS 501 + A + + AR+ Sbjct: 153 APNIASHISSISART 167
>REM1_SCHPO (O14332) Meiosis-specific cyclin rem1| Length = 402 Score = 31.2 bits (69), Expect = 3.7 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Frame = +2 Query: 464 DLSIQNRC-----HFEAAIWHKVLP*PSHHQHKDYQEYLLQPSPEE 586 ++S+QN C HF + WH + KDY +L P EE Sbjct: 33 EISLQNGCSPSDKHFPSQSWHGISSIEESQIQKDYDSFLASPLEEE 78
>PAX8_RAT (P51974) Paired box protein Pax-8| Length = 458 Score = 30.4 bits (67), Expect = 6.3 Identities = 23/81 (28%), Positives = 32/81 (39%), Gaps = 1/81 (1%) Frame = -3 Query: 656 TSASSPPDSDNEVHSSNSEGFHGFLQ-DLAGGDTPGNPCADDAKAMEELCARSLPQSDND 480 +SA +PP+S ++ HG L AG DT C D + C S+ + Sbjct: 162 SSAVTPPESPQSDSLGSTYSIHGLLGIAQAGSDTHRGRCDDSDQGQ---CRLSIDSQSSS 218 Query: 479 FGLRDQPLDDIFWHDSLGPLD 417 G R D F L PL+ Sbjct: 219 SGPRKHLRTDTFGQHHLEPLE 239 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 110,830,352 Number of Sequences: 219361 Number of extensions: 2328244 Number of successful extensions: 5880 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5877 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 8127969984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)