| Clone Name | rbags39a08 |
|---|---|
| Clone Library Name | barley_pub |
>GUC2E_MOUSE (P52785) Guanylyl cyclase GC-E precursor (EC 4.6.1.2) (Guanylate| cyclase 2E) Length = 1108 Score = 30.8 bits (68), Expect = 2.2 Identities = 17/51 (33%), Positives = 22/51 (43%) Frame = +1 Query: 343 CPLTTTGLQIPFDCLIVSRAYQAPPHLSRGLPVRIHLDLRDIRFLEQGHNG 495 C GL +P CL A S GLP RIH+++ +R L G Sbjct: 987 CVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNMSTVRILRSLDQG 1037
>TRPV1_HUMAN (Q8NER1) Transient receptor potential cation channel subfamily V| member 1 (TrpV1) (osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1) (Capsaicin receptor) Length = 839 Score = 30.4 bits (67), Expect = 2.9 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +3 Query: 9 SNCYVKNATCMHIPAEKR-ADIIILLHYTTTDVR*AAHELLHEKMPAGQPAEHFTRLPV 182 ++ Y K T +HI E+R ++ LL DV+ AAH +K G+P +F LP+ Sbjct: 196 TDSYYKGQTALHIAIERRNMALVTLLVENGADVQAAAHGDFFKK-TKGRPGFYFGELPL 253
>GUC2D_CANFA (O19179) Retinal guanylyl cyclase 1 precursor (EC 4.6.1.2) (Guanylate| cyclase 2D, retinal) (RETGC-1) (Rod outer segment membrane guanylate cyclase) (ROS-GC) (Guanylate cyclase E) (GC-E) Length = 1109 Score = 30.4 bits (67), Expect = 2.9 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +1 Query: 343 CPLTTTGLQIPFDCLIVSRAYQAPPHLSRGLPVRIHLDLRDIRFL 477 C GL +P CL A S GLP RIH+++ +R L Sbjct: 988 CVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNMSTVRIL 1032
>CO4_RAT (P08649) Complement C4 precursor [Contains: Complement C4 beta| chain; Complement C4 alpha chain; C4a anaphylatoxin; Complement C4 gamma chain] Length = 1737 Score = 30.4 bits (67), Expect = 2.9 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 10/40 (25%) Frame = +1 Query: 142 LLVSQQSTLLDFQ----------YSLHLKPNITELRTLIS 231 LL S +LDFQ +S+H+ P ITELR L+S Sbjct: 407 LLSGSDSKVLDFQQNTNGIGQVSFSIHVPPTITELRLLVS 446
>GUC2E_RAT (P51840) Guanylyl cyclase GC-E precursor (EC 4.6.1.2) (Guanylate| cyclase 2E) Length = 1108 Score = 30.4 bits (67), Expect = 2.9 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +1 Query: 343 CPLTTTGLQIPFDCLIVSRAYQAPPHLSRGLPVRIHLDLRDIRFL 477 C GL +P CL A S GLP RIH+++ +R L Sbjct: 987 CVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNMSTVRIL 1031
>GUC2C_CAVPO (P70106) Heat-stable enterotoxin receptor precursor (GC-C)| (Intestinal guanylate cyclase) (EC 4.6.1.2) (STA receptor) (Guanylyl cyclase C) Length = 1076 Score = 30.0 bits (66), Expect = 3.8 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 343 CPLTTTGLQIPFDCLIVSRAYQAPPHLSRGLPVRIHLDLRDIRFLEQ 483 C G++IP CL A S GLP+RIH+ I L++ Sbjct: 931 CAAGVVGIKIPRYCLFGDTVNTASRMESTGLPLRIHMSSSTIAILKR 977
>VL2_BPV2 (P06457) Minor capsid protein L2| Length = 467 Score = 30.0 bits (66), Expect = 3.8 Identities = 24/63 (38%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = -3 Query: 489 MPLFEEP-DVPEIEMDPNWQPTGQMRGSLVGSAYDQAIERYLQPGGGQRTNQTRPPGR*T 313 +PL EEP D EIE+D + + S + + R L PG G + TRP G T Sbjct: 349 IPLHEEPGDFEEIELDDLGEEHALLPKSYT-APIGSGVRRALIPGQG--FSATRPTGVVT 405 Query: 312 YGS 304 YGS Sbjct: 406 YGS 408
>GUC2D_HUMAN (Q02846) Retinal guanylyl cyclase 1 precursor (EC 4.6.1.2) (Guanylate| cyclase 2D, retinal) (RETGC-1) (Rod outer segment membrane guanylate cyclase) (ROS-GC) Length = 1103 Score = 28.9 bits (63), Expect = 8.5 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +1 Query: 343 CPLTTTGLQIPFDCLIVSRAYQAPPHLSRGLPVRIHLDLRDI---RFLEQGH 489 C GL +P CL A S GLP RIH++L + R L+ G+ Sbjct: 984 CVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNLSTVGILRALDSGY 1035
>CAC1S_RABIT (P07293) Voltage-dependent L-type calcium channel alpha-1S subunit| (Voltage-gated calcium channel alpha subunit Cav1.1) (Calcium channel, L type, alpha-1 polypeptide, isoform 3, skeletal muscle) Length = 1873 Score = 28.9 bits (63), Expect = 8.5 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = -3 Query: 495 PVMPLFEEPDVPEIEMDPNWQPTGQMRGSLVGSAYDQAIERYLQPGGGQR 346 P MP+ + P P + + GQ R SL GS D+A +R G R Sbjct: 1729 PGMPINQAPPAPCQQPSTDPPERGQRRTSLTGSLQDEAPQRRSSEGSTPR 1778
>TLE1_XENLA (O42469) Enhancer of split groucho-like protein 1| Length = 767 Score = 28.9 bits (63), Expect = 8.5 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +3 Query: 384 LDRKQSLPGSPSSVPWAASSDPSRS---PGHQVPRTG 485 L RK P SP+S+ ++S PSRS P QV + G Sbjct: 284 LQRKDPPPASPNSMTSSSSVSPSRSKDIPSQQVEKAG 320 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,756,623 Number of Sequences: 219361 Number of extensions: 1573375 Number of successful extensions: 4390 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 4215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4387 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)