| Clone Name | rbags38l04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EXTN_DAUCA (P06599) Extensin precursor | 32 | 2.1 | 2 | PLS1_MOUSE (Q9JJ00) Phospholipid scramblase 1 (PL scramblase 1) ... | 30 | 7.9 |
|---|
>EXTN_DAUCA (P06599) Extensin precursor| Length = 306 Score = 31.6 bits (70), Expect = 2.1 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 451 YRSPPYPHHSL--LYRLHFLNLIHPRPLHRSPPCPNHA 558 Y+SPP P HS ++ + + P P+++SPP P H+ Sbjct: 205 YKSPPPPKHSPAPVHHYKYKSPPPPTPVYKSPPPPEHS 242
>PLS1_MOUSE (Q9JJ00) Phospholipid scramblase 1 (PL scramblase 1)| (Ca(2+)-dependent phospholipid scramblase 1) (Transplantability-associated protein 1) (TRA1) (NOR1) Length = 328 Score = 29.6 bits (65), Expect = 7.9 Identities = 18/56 (32%), Positives = 23/56 (41%) Frame = +1 Query: 460 PPYPHHSLLYRLHFLNLIHPRPLHRSPPCPNHASSASY*FPIGLYAG*GPHGVALQ 627 PPYP + P+ ++ PP P Y P G YAG GP G +Q Sbjct: 23 PPYPPAAFQGPSDHAAYPIPQAGYQGPPGPYPGPQPGYPVPPGGYAGGGPSGFPVQ 78 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,494,966 Number of Sequences: 219361 Number of extensions: 1470094 Number of successful extensions: 3809 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3805 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)