| Clone Name | rbaal2f24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BAIG_EUBSP (P32369) Bile acid transporter | 32 | 1.8 | 2 | PA99_PSEAE (Q9HUG6) Putative lipopolysaccharide biosynthesis pro... | 30 | 9.1 | 3 | E1A_ADE07 (P03256) Early E1A 28 kDa protein | 30 | 9.1 |
|---|
>BAIG_EUBSP (P32369) Bile acid transporter| Length = 477 Score = 32.0 bits (71), Expect = 1.8 Identities = 28/107 (26%), Positives = 48/107 (44%), Gaps = 2/107 (1%) Frame = -1 Query: 466 LLLATMPSITSYLRRSLEWQTPKVVGFELFSSLVMAFISWQLFSACQRPM*STKQSSARF 287 L++A M ++ ++R + P V F+ +M +I L S P+ K+ Sbjct: 280 LMMANMTNVIVFVR----YTQPDNVIISSFAISIM-YIGMSLGSVIIGPVADKKEPKTVL 334 Query: 286 TGDLALPR--CLLLYLGKIRMLLRAFATTITICGGSVAEHFTLFLSV 152 T L L C L+YL K + FA ++ I G + + T+F+ V Sbjct: 335 TFSLVLTAIGCALMYLFKADSSVAIFAASLGILGFGLGGNATIFMKV 381
>PA99_PSEAE (Q9HUG6) Putative lipopolysaccharide biosynthesis protein PA4999| Length = 401 Score = 29.6 bits (65), Expect = 9.1 Identities = 21/65 (32%), Positives = 32/65 (49%) Frame = -1 Query: 592 DFRRLTFVLLQVMTLSLAALGSLMWLRKNKPRTLIPIIYACALLLATMPSITSYLRRSLE 413 D+ RL ++LL TL L +PR L P+ L +A + + +SY+ SL Sbjct: 42 DYHRLFYILLAAPTLLYVIL---------QPRLLRPLT-GSPLFIAFL-AFSSYMMLSLS 90 Query: 412 WQTPK 398 W TP+ Sbjct: 91 WSTPE 95
>E1A_ADE07 (P03256) Early E1A 28 kDa protein| Length = 261 Score = 29.6 bits (65), Expect = 9.1 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 105 SLCYSRAH*IMCFRPIT-DKNKVKCSATEPPQI-VMVVAKALSSILILPKYNKR 260 SLCY R H + P++ D++ S T PP+I A I + PK KR Sbjct: 181 SLCYMRMHCHFIYSPVSDDESPSPDSTTSPPEIQAPAPANVCKPIPVKPKPGKR 234 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,288,864 Number of Sequences: 219361 Number of extensions: 1929166 Number of successful extensions: 4296 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4296 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6856295237 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)