| Clone Name | rbags38i18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YN81_CAEEL (Q03610) Hypothetical protein ZC84.1 in chromosome III | 31 | 3.5 | 2 | HNF1B_PIG (Q03365) Hepatocyte nuclear factor 1-beta (HNF-1beta) ... | 30 | 5.9 | 3 | HNF1B_MOUSE (P27889) Hepatocyte nuclear factor 1-beta (HNF-1beta... | 30 | 7.7 |
|---|
>YN81_CAEEL (Q03610) Hypothetical protein ZC84.1 in chromosome III| Length = 1416 Score = 31.2 bits (69), Expect = 3.5 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -3 Query: 730 NYIQCIASGGQPPNYKFYFYGQKAGAAAVYLVECIVNTAS 611 N++ C G P NY+ YF G + G C +NT S Sbjct: 505 NFVTCSNGMGCPANYECYFDGSQWGCCPTKAFTCSLNTDS 544
>HNF1B_PIG (Q03365) Hepatocyte nuclear factor 1-beta (HNF-1beta) (HNF-1B)| (Variant hepatic nuclear factor 1) (VHNF1) (FPC-binding protein) (FPCB) Length = 559 Score = 30.4 bits (67), Expect = 5.9 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +3 Query: 84 LLHPANKLQMSIYSLHISGGGIHLQSSNKVTHHLNHHYPEE 206 LL P K+Q+S+ SGGG+ S+ H L+HH P++ Sbjct: 396 LLSPDGKMQISV-----SGGGLPPVSTLTNIHSLSHHNPQQ 431
>HNF1B_MOUSE (P27889) Hepatocyte nuclear factor 1-beta (HNF-1beta) (HNF-1B)| (Variant hepatic nuclear factor 1) (VHNF1) (Homeoprotein LFB3) Length = 558 Score = 30.0 bits (66), Expect = 7.7 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +3 Query: 81 ALLHPANKLQMSIYSLHISGGGIHLQSSNKVTHHLNHHYPEE 206 +LL P +K+Q+++ SGGG+ S+ H L+HH P++ Sbjct: 394 SLLSPDSKMQITV-----SGGGLPPVSTLTNIHSLSHHNPQQ 430 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 107,143,160 Number of Sequences: 219361 Number of extensions: 2240159 Number of successful extensions: 5263 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5084 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5260 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7592921998 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)