| Clone Name | rbags38i16 |
|---|---|
| Clone Library Name | barley_pub |
>COL12_ARATH (Q9LJ44) Putative zinc finger protein CONSTANS-LIKE 12| Length = 337 Score = 30.0 bits (66), Expect = 5.3 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +3 Query: 159 GCPAEESHNLPWSSHRCLSLQPPKHGNLMDPE*LGQFLVNDILNT 293 GCP+ N WSS L+PP G L+ P +G F +ND+ NT Sbjct: 93 GCPSPTDFNRMWSS----ILEPPVSG-LLSPF-VGSFPLNDLNNT 131
>Y480_MYCTU (Q11146) Hypothetical UPF0012 protein Rv0480c/MT0498 (EC 3.5.-.-)| Length = 340 Score = 29.6 bits (65), Expect = 6.9 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = -2 Query: 570 ARTHRGSSSISPRGIARSLVLSRPCEGLFSSGNMSKNIIAKLFPD 436 ART G+SS +P G+ SLV S E + S+G + ++A + D Sbjct: 268 ARTGVGASSAAPTGVGGSLVASPLGEVVVSAGTQPQLLVADIDVD 312
>VPE_SOYBN (P49045) Vacuolar processing enzyme precursor (EC 3.4.22.-) (VPE)| Length = 495 Score = 29.3 bits (64), Expect = 9.0 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -1 Query: 391 ASCSYKEFAIYVASTEAAAVLEGL 320 AS SYKE IYV + E+ +V EG+ Sbjct: 206 ASGSYKEMVIYVEACESGSVFEGI 229
>VATA_NANEQ (Q74MJ7) V-type ATP synthase alpha chain (EC 3.6.3.14) (V-type| ATPase subunit A) Length = 570 Score = 29.3 bits (64), Expect = 9.0 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -3 Query: 596 LRKIPSELGRVHIED-HPAYLLEALQEALSLVGPVKGYSALE 474 LR+I S LG + E+ +PAYLL L E G V+ + LE Sbjct: 329 LREISSRLGEIPSEEGYPAYLLRKLAEFYERSGRVRTLNDLE 370
>ZP2_RABIT (P48829) Zona pellucida sperm-binding protein 2 precursor (Zona| pellucida glycoprotein ZP2) (Zona pellucida protein A) (75 kDa zona pellucida protein) (Fragment) Length = 666 Score = 29.3 bits (64), Expect = 9.0 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 379 YKEFAIYVASTEAAAVLEGLRVGARDLKPVFR 284 + +F +Y T+ A L+ LRVG+ +PVF+ Sbjct: 325 FMDFEVYTHQTKPALNLDTLRVGSSSCQPVFK 356 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,061,158 Number of Sequences: 219361 Number of extensions: 1678139 Number of successful extensions: 3751 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3750 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)