| Clone Name | rbags37p19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FREM3_MOUSE (Q5H8B9) FRAS1-related extracellular matrix protein ... | 30 | 6.0 | 2 | EXO5_BPT5 (P06229) Exodeoxyribonuclease (EC 3.1.11.3) (5'exonucl... | 30 | 6.0 |
|---|
>FREM3_MOUSE (Q5H8B9) FRAS1-related extracellular matrix protein 3 precursor (NV| domain-containing protein 2) Length = 2123 Score = 30.0 bits (66), Expect = 6.0 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 2/63 (3%) Frame = +1 Query: 1 LFSLRKTPK-GHLTTDNXPGKQPASTVERQLEAEQ-PVKKKSRMKIILVFFFLRPIAAHQ 174 L+S+ + P GHL + + PG+ AS + QL + S KI L F LR H Sbjct: 1450 LYSITRAPSTGHLESSDQPGEPMASFTQLQLARNKISYVHISNDKIKLDHFELRVTGGHH 1509 Query: 175 SEN 183 SE+ Sbjct: 1510 SES 1512
>EXO5_BPT5 (P06229) Exodeoxyribonuclease (EC 3.1.11.3) (5'exonuclease)| Length = 290 Score = 30.0 bits (66), Expect = 6.0 Identities = 16/69 (23%), Positives = 36/69 (52%), Gaps = 6/69 (8%) Frame = -3 Query: 586 IQDIEEXVSIEV------EGCKGMGGMGQERDIHMIKEXDSQAIIIDXKDGSPGPRSRMV 425 + D+E+ +S++ + +G+ G+G +R ++I+E + ++D D P P + Sbjct: 185 VDDVEQFISLKAIMGDLGDNIRGVEGIGAKRGYNIIREFGN---VLDIIDQLPLPGKQKY 241 Query: 424 VQDXGADNE 398 +Q+ A E Sbjct: 242 IQNLNASEE 250 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,497,856 Number of Sequences: 219361 Number of extensions: 1553270 Number of successful extensions: 3562 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3561 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5881538857 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)