| Clone Name | rbags38e23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PI3R6_HUMAN (Q5UE93) Phosphoinositide 3-kinase regulatory subuni... | 31 | 4.2 | 2 | MADCA_HUMAN (Q13477) Mucosal addressin cell adhesion molecule 1 ... | 30 | 7.2 |
|---|
>PI3R6_HUMAN (Q5UE93) Phosphoinositide 3-kinase regulatory subunit 6| (Phosphoinositide 3-kinase gamma adapter protein of 87 kDa) (p87 PI3K adapter protein) (p87PIKAP) Length = 754 Score = 30.8 bits (68), Expect = 4.2 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +2 Query: 299 WYPQAINSLAP*HYKTRSSFCLQNRSLPPSLTHSLLIQLFILDPNSMIIHLTDQPL 466 WY +N+L P +K +PPSL S + FILD + I + QP+ Sbjct: 487 WYQSNVNTLCPAIHKLAE--------MPPSLDTSRTVDPFILDVITYYIRMGTQPI 534
>MADCA_HUMAN (Q13477) Mucosal addressin cell adhesion molecule 1 precursor| (MAdCAM-1) (hMAdCAM-1) Length = 406 Score = 30.0 bits (66), Expect = 7.2 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +3 Query: 195 IIYMVADLRRD*PFLVNTPSSCLCAATERKPTQHAGIHRQLIPLLHSIT 341 +++ V + R P P + C AT R P HRQ IP+LHS T Sbjct: 181 VLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELS-HRQAIPVLHSPT 228 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,123,637 Number of Sequences: 219361 Number of extensions: 2021673 Number of successful extensions: 4939 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4938 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7082949625 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)