| Clone Name | rbags37o05 |
|---|---|
| Clone Library Name | barley_pub |
>SFR16_MOUSE (Q8CFC7) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) (Clk4-associating SR-related protein) Length = 653 Score = 42.0 bits (97), Expect = 0.002 Identities = 22/48 (45%), Positives = 29/48 (60%) Frame = -3 Query: 572 AEKKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAEV 429 A+ K TPQERLK M K LN+Q + D A K +QE +R E+ E+ Sbjct: 547 AKPKLTPQERLKLRMQKALNRQFKADKKAAQEKMIQQEHERQEREDEL 594
>SFR16_HUMAN (Q8N2M8) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) Length = 659 Score = 40.8 bits (94), Expect = 0.004 Identities = 21/48 (43%), Positives = 29/48 (60%) Frame = -3 Query: 572 AEKKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAEV 429 A+ K TPQE+LK M K LN+Q + D A K +QE +R E+ E+ Sbjct: 553 AKPKLTPQEKLKLRMQKALNRQFKADKKAAQEKMIQQEHERQEREDEL 600
>GAG_MSVMO (P03334) Gag polyprotein R65 [Contains: Core protein p15; Inner| coat protein p12; Core shell protein p30; Nucleoprotein p10] Length = 537 Score = 36.6 bits (83), Expect = 0.078 Identities = 17/46 (36%), Positives = 33/46 (71%) Frame = -3 Query: 566 KKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAEV 429 K+ETP+ER +RI ++ K+ R+ T E K++E++R+RH +++ + Sbjct: 432 KRETPEEREERIRREREEKEERRRTEDE-QKEKERDRRRHREMSRL 476
>GAG_MLVAV (P03336) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 536 Score = 36.2 bits (82), Expect = 0.10 Identities = 16/46 (34%), Positives = 33/46 (71%) Frame = -3 Query: 566 KKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAEV 429 K+ETP+ER +R+ + K+ R+ A E K++E++R+RH +++++ Sbjct: 431 KRETPEEREERVRRETEEKEERR-RAEEEQKEKERDRRRHREMSKL 475
>GAG_MLVMO (P03332) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 537 Score = 36.2 bits (82), Expect = 0.10 Identities = 17/46 (36%), Positives = 33/46 (71%) Frame = -3 Query: 566 KKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAEV 429 K+ETP+ER +RI + K+ R+ T E K++E++R+RH +++++ Sbjct: 432 KRETPEEREERIRRETEEKEERRRTEDE-QKEKERDRRRHREMSKL 476
>GAG_MLVCB (P27460) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 535 Score = 35.4 bits (80), Expect = 0.17 Identities = 16/46 (34%), Positives = 33/46 (71%) Frame = -3 Query: 566 KKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAEV 429 K+ETP+ER +RI + K+ R+ A + K++E++R+RH +++++ Sbjct: 430 KRETPEEREERIKRETEEKEERR-RAEDEQKEKERDRRRHREMSKL 474
>GAG_MLVFF (P26806) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 537 Score = 34.7 bits (78), Expect = 0.30 Identities = 15/46 (32%), Positives = 33/46 (71%) Frame = -3 Query: 566 KKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAEV 429 K+ETP+ER +RI + K+ R+ A + +++E++R+RH +++++ Sbjct: 432 KRETPEEREERIRRETEEKEERR-RAEDVQREKERDRRRHREMSKL 476
>GAG_MLVF5 (P26807) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 538 Score = 34.3 bits (77), Expect = 0.39 Identities = 15/46 (32%), Positives = 33/46 (71%) Frame = -3 Query: 566 KKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAEV 429 K+ETP+ER +RI + K+ R+ A + +++E++R+RH +++++ Sbjct: 433 KRETPEEREERIRRETEEKEERR-RAEDEQREKERDRRRHREMSKL 477
>GAG_MLVDE (P29168) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 535 Score = 33.9 bits (76), Expect = 0.50 Identities = 15/45 (33%), Positives = 32/45 (71%) Frame = -3 Query: 566 KKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAE 432 K+ETP+ER +RI + K+ R+ A + +++E++R+RH ++++ Sbjct: 430 KRETPEEREERIRRETEEKEERR-RAEDEQREKERDRRRHREMSK 473
>GAG_MLVFP (P26805) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 537 Score = 33.9 bits (76), Expect = 0.50 Identities = 14/46 (30%), Positives = 33/46 (71%) Frame = -3 Query: 566 KKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAEV 429 K+ETP+ER +R+ + K+ R+ A + +++E++R+RH +++++ Sbjct: 432 KRETPEEREERVRRETEEKEERR-RAEDERREKERDRRRHREMSKL 476
>GAG_MLVDU (P23090) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 528 Score = 33.9 bits (76), Expect = 0.50 Identities = 15/45 (33%), Positives = 32/45 (71%) Frame = -3 Query: 566 KKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAE 432 K+ETP+ER +RI + K+ R+ A + +++E++R+RH ++++ Sbjct: 423 KRETPEEREERIRRETEEKEERR-RAEDEQREKERDRRRHREMSK 466
>GAG_MLVHO (P21435) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 539 Score = 33.5 bits (75), Expect = 0.66 Identities = 15/46 (32%), Positives = 32/46 (69%) Frame = -3 Query: 566 KKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAEV 429 K+ETP+ER +RI + K+ R+ A +++E++R+RH +++++ Sbjct: 434 KRETPEEREERIRRETEEKEERR-RAENEQREKERDRRRHREMSKL 478
>INCE_CHICK (P53352) Inner centromere protein| Length = 877 Score = 32.0 bits (71), Expect = 1.9 Identities = 16/51 (31%), Positives = 31/51 (60%), Gaps = 2/51 (3%) Frame = -3 Query: 575 QAEKKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQER--QRHEKLAEV 429 Q + KE +++L+ + K+ +Q+RK E K+R++E +R E+L +V Sbjct: 499 QHDPKEKERQKLQALRKKEEAEQLRKQKVEEEKKRRQEEAKLRREERLRKV 549 Score = 31.6 bits (70), Expect = 2.5 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 3/46 (6%) Frame = -3 Query: 569 EKKETPQERLKRIMSKQLNKQIRKDTAA---ETAKKREQERQRHEK 441 +KKE QER ++I ++ +Q R+ A E +K+EQER++ E+ Sbjct: 634 KKKEEEQERARKIAEQRQAEQEREKQLAAEREQERKKEQERKKEEE 679
>GAG_MLVBM (P29167) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 536 Score = 31.6 bits (70), Expect = 2.5 Identities = 14/46 (30%), Positives = 32/46 (69%) Frame = -3 Query: 566 KKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAEV 429 K+ETP+ER +RI + K+ R+ A + +++E++R+R +++++ Sbjct: 431 KRETPEEREERIRRETEEKEERR-RAGDEQREKERDRRRQREMSKL 475
>E3GL_ADE35 (P68981) Early E3 18.5 kDa glycoprotein precursor (GP19K) (E3-19K)| (E3gp 19-kDa) (E19) Length = 166 Score = 30.4 bits (67), Expect = 5.6 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 175 TFSALICFCTCSITALQMVCIFKSSGTYLSTMN 273 TFS C C C +TAL VCI T + N Sbjct: 128 TFSIAYCLCACLLTALLCVCIHLLVTTRIKNAN 160
>E3GL_ADE1P (P68980) Early E3 18.5 kDa glycoprotein precursor (GP19K) (E3-19K)| (E3gp 19-kDa) (E19) Length = 166 Score = 30.4 bits (67), Expect = 5.6 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 175 TFSALICFCTCSITALQMVCIFKSSGTYLSTMN 273 TFS C C C +TAL VCI T + N Sbjct: 128 TFSIAYCLCACLLTALLCVCIHLLVTTRIKNAN 160
>E3GL_ADE1A (P35771) Early E3 18.5 kDa glycoprotein precursor (GP19K) (E3-19K)| (E3gp 19-kDa) (E19) Length = 166 Score = 30.4 bits (67), Expect = 5.6 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 175 TFSALICFCTCSITALQMVCIFKSSGTYLSTMN 273 TFS C C C +TAL VCI T + N Sbjct: 128 TFSIAYCLCACLLTALLCVCIHLLVTTRIKNAN 160
>SSF1_YEAST (P38789) Ribosome biogenesis protein SSF1| Length = 453 Score = 30.0 bits (66), Expect = 7.3 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -3 Query: 569 EKKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAEVG 426 EK+ + RLK K+ + I K A + AKK+ + +R + AE G Sbjct: 368 EKRHAAKMRLKEQRKKEQEENIAKKKAVKDAKKQRKLERRKARAAEGG 415
>MAP1B_RAT (P15205) Microtubule-associated protein 1B (MAP 1B) (Neuraxin)| [Contains: MAP1 light chain LC1] Length = 2459 Score = 29.6 bits (65), Expect = 9.5 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = -3 Query: 569 EKKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAE 432 EKKE +E K K K+++KD E K+ ++ ++ +K+++ Sbjct: 689 EKKELKKEVKKETPLKDAKKEVKKDEKKEVKKEEKEPKKEIKKISK 734 Score = 29.6 bits (65), Expect = 9.5 Identities = 12/42 (28%), Positives = 27/42 (64%) Frame = -3 Query: 569 EKKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHE 444 E K+ ++ +K+ K+L K+++K+T + AKK ++ ++ E Sbjct: 676 EAKKEIKKEIKKEEKKELKKEVKKETPLKDAKKEVKKDEKKE 717
>BAZ2B_HUMAN (Q9UIF8) Bromodomain adjacent to zinc finger domain 2B (hWALp4)| Length = 1972 Score = 29.6 bits (65), Expect = 9.5 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = -3 Query: 551 QERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAE 432 QE++KRI ++ K++R E AKK+++E + KL E Sbjct: 748 QEKIKRIQQIRMEKELRAQQILE-AKKKKKEEAANAKLLE 786
>EGL27_CAEEL (Q09228) Egg-laying defective protein 27| Length = 1129 Score = 29.6 bits (65), Expect = 9.5 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = -3 Query: 551 QERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLA 435 Q+ + R+M +Q ++ AA+ +R+QER+R E+ A Sbjct: 973 QQDIARLMEMAAQQQQQQQQAAQAQAQRDQERERREREA 1011
>MAP1B_MOUSE (P14873) Microtubule-associated protein 1B (MAP 1B) (MAP1.2)| (MAP1(X)) [Contains: MAP1 light chain LC1] Length = 2464 Score = 29.6 bits (65), Expect = 9.5 Identities = 14/41 (34%), Positives = 27/41 (65%) Frame = -3 Query: 566 KKETPQERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHE 444 KKE +E +K+ K+L K+++K+T + AKK ++ ++ E Sbjct: 679 KKEIKKE-IKKEERKELKKEVKKETPLKDAKKEVKKEEKKE 718
>BAZ2B_CHICK (Q9DE13) Bromodomain adjacent to zinc finger domain 2B| (Extracellular matrix protein F22) Length = 2130 Score = 29.6 bits (65), Expect = 9.5 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = -3 Query: 551 QERLKRIMSKQLNKQIRKDTAAETAKKREQERQRHEKLAE 432 QE++KRI ++ K++R E AKK+++E + KL E Sbjct: 858 QEKIKRIQQIRMEKELRAQQILE-AKKKKKEEAANAKLLE 896
>TRHY_HUMAN (Q07283) Trichohyalin| Length = 1898 Score = 29.6 bits (65), Expect = 9.5 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 11/55 (20%) Frame = -3 Query: 569 EKKETPQERLKRIMSKQLNKQIRKDTAA-----------ETAKKREQERQRHEKL 438 E++E ++RLKR ++L ++ R+D E K EQE +RHE+L Sbjct: 612 EQEERLEQRLKREEVERLEQEERRDERLKREEPEEERRHELLKSEEQEERRHEQL 666
>INCE_MOUSE (Q9WU62) Inner centromere protein| Length = 880 Score = 29.6 bits (65), Expect = 9.5 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 4/46 (8%) Frame = -3 Query: 566 KKETPQERLK----RIMSKQLNKQIRKDTAAETAKKREQERQRHEK 441 KKE QER K R +++Q ++ R++ ++REQER+ E+ Sbjct: 641 KKEEEQERRKAAEARRLAEQREQERRREQERREQERREQERREQER 686 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,356,322 Number of Sequences: 219361 Number of extensions: 1334432 Number of successful extensions: 3867 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 3636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3854 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7196276819 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)