| Clone Name | rbags37n05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PARC_RICCN (Q92JH0) DNA topoisomerase 4 subunit A (EC 5.99.1.-) ... | 33 | 0.66 | 2 | LEPA_BLOPB (Q492C9) GTP-binding protein lepA | 32 | 1.9 | 3 | L_NDVB (P11205) Large structural protein (Protein L) (Transcript... | 31 | 4.3 |
|---|
>PARC_RICCN (Q92JH0) DNA topoisomerase 4 subunit A (EC 5.99.1.-) (Topoisomerase| IV subunit A) Length = 738 Score = 33.5 bits (75), Expect = 0.66 Identities = 25/78 (32%), Positives = 38/78 (48%) Frame = -1 Query: 694 AILKRQLWR*TMKMEQITIVKWIVEIQKLVIILESLSNGAYAHWGI*SHFLDSMQQRFGL 515 AIL +L R K+E+ I+ +QK ILE + N W I + ++Q +FGL Sbjct: 419 AILNTRL-RSLRKLEEQEIINEHSNLQKQQAILEEILNNPKELWKIVKKEIKTVQTKFGL 477 Query: 514 TSACWTRRFSSGVFTLSS 461 + RR S TL++ Sbjct: 478 NTVIGARRTSFEEVTLTN 495
>LEPA_BLOPB (Q492C9) GTP-binding protein lepA| Length = 600 Score = 32.0 bits (71), Expect = 1.9 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -3 Query: 710 VTFPVSDPEAATMEIDNENGADNNSQVDCGNTKAGYNIGEL 588 + +DP A+ EI N G D N+ + C + K GY I EL Sbjct: 134 IDLSTADPNRASQEIKNIIGIDVNNAIQC-SAKTGYGIPEL 173
>L_NDVB (P11205) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2204 Score = 30.8 bits (68), Expect = 4.3 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = -2 Query: 411 CNSPLIPHHHGLEDDL*KQAVITFLTNSEMSHPRI 307 C++PL+ H +++ ++A+ FL N E+ HPR+ Sbjct: 1003 CSNPLLSGVHTEDNEAEEKALAEFLLNQEVIHPRV 1037 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 105,523,374 Number of Sequences: 219361 Number of extensions: 2198839 Number of successful extensions: 4925 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4923 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7252940416 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)