| Clone Name | rbags38b22 |
|---|---|
| Clone Library Name | barley_pub |
>HDAC5_HUMAN (Q9UQL6) Histone deacetylase 5 (HD5) (Antigen NY-CO-9)| Length = 1122 Score = 31.6 bits (70), Expect = 1.6 Identities = 21/65 (32%), Positives = 30/65 (46%) Frame = +3 Query: 54 LPLLQSAEQRKEQHLARTMDRLHRPESLTSDRPPETPGTKTPAYSHPGGTNQTLPQRERI 233 L +L++ E+ KE +A T +L E L S TPG G N +LPQ + Sbjct: 164 LLILRNKEKSKESAIASTEVKLRLQEFLLSKSKEPTPG----------GLNHSLPQHPKC 213 Query: 234 IGLHN 248 G H+ Sbjct: 214 WGAHH 218
>HDAC5_MOUSE (Q9Z2V6) Histone deacetylase 5 (HD5) (Histone deacetylase mHDA1)| Length = 1113 Score = 31.6 bits (70), Expect = 1.6 Identities = 21/65 (32%), Positives = 30/65 (46%) Frame = +3 Query: 54 LPLLQSAEQRKEQHLARTMDRLHRPESLTSDRPPETPGTKTPAYSHPGGTNQTLPQRERI 233 L +L++ E+ KE +A T +L E L S TPG G N +LPQ + Sbjct: 155 LLILRNKEKSKESAIASTEVKLRLQEFLLSKSKEPTPG----------GLNHSLPQHPKC 204 Query: 234 IGLHN 248 G H+ Sbjct: 205 WGAHH 209
>TRA2_CAEBR (Q17307) Sex-determining transformer protein 2 precursor (Cb-Tra-2A)| Length = 1497 Score = 29.3 bits (64), Expect = 7.8 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 75 EQRKEQHLARTMDRLHRPESLTSDRPPETPG 167 E+R+EQHL R +RPES P +TPG Sbjct: 1471 ERRREQHLREQEARRNRPES-----PDDTPG 1496
>FCA_ARATH (O04425) Flowering time control protein FCA| Length = 747 Score = 29.3 bits (64), Expect = 7.8 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 7/67 (10%) Frame = +3 Query: 45 MTSLPLLQSAEQRKEQHLARTMDRLHRPESLTSDRPPET--PGTKTP-----AYSHPGGT 203 ++S LQ + QH+ LH P+ L P+T PG + P AYS T Sbjct: 394 VSSSATLQQQNRAAGQHITPLKKPLHSPQGLPLPLRPQTNFPGAQAPLQNPYAYSSQLPT 453 Query: 204 NQTLPQR 224 +Q PQ+ Sbjct: 454 SQLPPQQ 460
>ADA3_YEAST (P32494) Transcriptional adapter 3 (NGG1 protein)| Length = 702 Score = 29.3 bits (64), Expect = 7.8 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 120 HRPESLTSDRPPETPGTKTPAYSHPGGTNQTLPQRERIIGLHNEQGLET 266 ++ + + D+ P K P +QTLP+ +GL NE+GLE+ Sbjct: 205 NKKQKIDVDKMENDPTVKNPKSEFV--VSQTLPRAAAALGLFNEEGLES 251 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,212,872 Number of Sequences: 219361 Number of extensions: 1489335 Number of successful extensions: 3794 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3681 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3793 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)