| Clone Name | rbags37m18 |
|---|---|
| Clone Library Name | barley_pub |
>VATL_TOBAC (Q40585) Vacuolar ATP synthase 16 kDa proteolipid subunit (EC| 3.6.3.14) Length = 165 Score = 30.0 bits (66), Expect = 1.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 105 QPKLFXGMXXXXXXXXXXXXXXXIVGIILSXRXGQ 1 QPKLF GM IVGIILS R GQ Sbjct: 127 QPKLFVGMILILIFAEALALYGLIVGIILSSRAGQ 161
>VATL_ORYSA (Q40635) Vacuolar ATP synthase 16 kDa proteolipid subunit (EC| 3.6.3.14) Length = 165 Score = 30.0 bits (66), Expect = 1.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 105 QPKLFXGMXXXXXXXXXXXXXXXIVGIILSXRXGQ 1 QPKLF GM IVGIILS R GQ Sbjct: 127 QPKLFVGMILILIFAEALALYGLIVGIILSSRAGQ 161
>VATL_MESCR (P68161) Vacuolar ATP synthase 16 kDa proteolipid subunit (EC| 3.6.3.14) Length = 165 Score = 30.0 bits (66), Expect = 1.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 105 QPKLFXGMXXXXXXXXXXXXXXXIVGIILSXRXGQ 1 QPKLF GM IVGIILS R GQ Sbjct: 127 QPKLFVGMILILIFAEALALYGLIVGIILSSRAGQ 161
>VATL_KALDA (Q96473) Vacuolar ATP synthase 16 kDa proteolipid subunit (EC| 3.6.3.14) (V-type H+-ATPase 16 kDa subunit) Length = 165 Score = 30.0 bits (66), Expect = 1.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 105 QPKLFXGMXXXXXXXXXXXXXXXIVGIILSXRXGQ 1 QPKLF GM IVGIILS R GQ Sbjct: 127 QPKLFVGMILILIFAEALALYGLIVGIILSSRAGQ 161
>VATL_GOSHI (Q43434) Vacuolar ATP synthase 16 kDa proteolipid subunit (EC| 3.6.3.14) Length = 165 Score = 30.0 bits (66), Expect = 1.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 105 QPKLFXGMXXXXXXXXXXXXXXXIVGIILSXRXGQ 1 QPKLF GM IVGIILS R GQ Sbjct: 127 QPKLFVGMILILIFAEALALYGLIVGIILSSRAGQ 161
>VATL_BETVU (P68162) Vacuolar ATP synthase 16 kDa proteolipid subunit (EC| 3.6.3.14) Length = 165 Score = 30.0 bits (66), Expect = 1.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 105 QPKLFXGMXXXXXXXXXXXXXXXIVGIILSXRXGQ 1 QPKLF GM IVGIILS R GQ Sbjct: 127 QPKLFVGMILILIFAEALALYGLIVGIILSSRAGQ 161
>VATL_AVESA (P23957) Vacuolar ATP synthase 16 kDa proteolipid subunit (EC| 3.6.3.14) Length = 165 Score = 30.0 bits (66), Expect = 1.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 105 QPKLFXGMXXXXXXXXXXXXXXXIVGIILSXRXGQ 1 QPKLF GM IVGIILS R GQ Sbjct: 127 QPKLFVGMILILIFAEALALYGLIVGIILSSRAGQ 161
>VATL2_ARATH (P59228) Vacuolar ATP synthase 16 kDa proteolipid subunit 2 (EC| 3.6.3.14) (V-ATPase 16 kDa proteolipid subunit 2) Length = 165 Score = 30.0 bits (66), Expect = 1.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 105 QPKLFXGMXXXXXXXXXXXXXXXIVGIILSXRXGQ 1 QPKLF GM IVGIILS R GQ Sbjct: 127 QPKLFVGMILILIFAEALALYGLIVGIILSSRAGQ 161
>VATL_PHAAU (O22552) Vacuolar ATP synthase 16 kDa proteolipid subunit (EC| 3.6.3.14) Length = 164 Score = 30.0 bits (66), Expect = 1.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 105 QPKLFXGMXXXXXXXXXXXXXXXIVGIILSXRXGQ 1 QPKLF GM IVGIILS R GQ Sbjct: 126 QPKLFVGMILILIFAEALALYGLIVGIILSSRAGQ 160
>VATL_LYCES (O24011) Vacuolar ATP synthase 16 kDa proteolipid subunit (EC| 3.6.3.14) Length = 164 Score = 30.0 bits (66), Expect = 1.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 105 QPKLFXGMXXXXXXXXXXXXXXXIVGIILSXRXGQ 1 QPKLF GM IVGIILS R GQ Sbjct: 126 QPKLFVGMILILIFAEALALYGLIVGIILSSRAGQ 160
>VATL1_ARATH (P59227) Vacuolar ATP synthase 16 kDa proteolipid subunit 1/3/5 (EC| 3.6.3.14) (V-ATPase 16 kDa proteolipid subunit 1/3/5) Length = 164 Score = 30.0 bits (66), Expect = 1.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 105 QPKLFXGMXXXXXXXXXXXXXXXIVGIILSXRXGQ 1 QPKLF GM IVGIILS R GQ Sbjct: 126 QPKLFVGMILILIFAEALALYGLIVGIILSSRAGQ 160
>VATL_MAIZE (Q41773) Vacuolar ATP synthase 16 kDa proteolipid subunit (EC| 3.6.3.14) (V-ATPase 16 kDa proteolipid subunit) (Fragment) Length = 109 Score = 30.0 bits (66), Expect = 1.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 105 QPKLFXGMXXXXXXXXXXXXXXXIVGIILSXRXGQ 1 QPKLF GM IVGIILS R GQ Sbjct: 71 QPKLFVGMILILIFAEALALYGLIVGIILSSRAGQ 105
>VATL4_ARATH (P59229) Vacuolar ATP synthase 16 kDa proteolipid subunit 4 (EC| 3.6.3.14) (V-ATPase 16 kDa proteolipid subunit 4) Length = 166 Score = 30.0 bits (66), Expect = 1.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 105 QPKLFXGMXXXXXXXXXXXXXXXIVGIILSXRXGQ 1 QPKLF GM IVGIILS R GQ Sbjct: 128 QPKLFVGMILILIFAEALALYGLIVGIILSSRAGQ 162 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,447,373 Number of Sequences: 219361 Number of extensions: 27433 Number of successful extensions: 60 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 80,573,946 effective HSP length: 10 effective length of database: 78,380,336 effective search space used: 1881128064 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)