| Clone Name | rbags37m06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DCUP_SYNP7 (P16891) Uroporphyrinogen decarboxylase (EC 4.1.1.37)... | 31 | 2.8 | 2 | ANM2_HUMAN (P55345) Protein arginine N-methyltransferase 2 (EC 2... | 30 | 6.3 | 3 | PORCN_DROME (Q9VWV9) Protein-cysteine N-palmitoyltransferase por... | 30 | 6.3 |
|---|
>DCUP_SYNP7 (P16891) Uroporphyrinogen decarboxylase (EC 4.1.1.37) (URO-D) (UPD)| Length = 354 Score = 31.2 bits (69), Expect = 2.8 Identities = 21/66 (31%), Positives = 31/66 (46%) Frame = -1 Query: 326 QQIGNSLVEILLCGLPYCGGTHLLLE*PFSFVCNTKHLAYRRST*LHDLLVQNLEN*FIN 147 Q++GN + G P+ + + N KHLA+ T LH+LL + +N I Sbjct: 134 QEVGNEAAVLGFAGAPWTLAAYAIEGKSSKTYANIKHLAFSEPTILHELLGKLADNIAI- 192 Query: 146 YLAIQI 129 YL QI Sbjct: 193 YLCHQI 198
>ANM2_HUMAN (P55345) Protein arginine N-methyltransferase 2 (EC 2.1.1.-)| Length = 433 Score = 30.0 bits (66), Expect = 6.3 Identities = 13/56 (23%), Positives = 28/56 (50%) Frame = +2 Query: 371 VLAQAPLSPQVYMQLDL*ISSSTDTVLKRPIKTGKLLAKLQPVWRQHVLATMTFSI 538 VL+ P P + + L + V + TG ++ + PVWR+H+ +++++ Sbjct: 358 VLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAV 413
>PORCN_DROME (Q9VWV9) Protein-cysteine N-palmitoyltransferase porcupine (EC| 2.3.1.-) Length = 525 Score = 30.0 bits (66), Expect = 6.3 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +2 Query: 188 VIMCFFCKLDALCYIQRKRATPTADVYLRNMVAHIVV 298 +++C C+L L Y QR+R T A ++L + +++ Sbjct: 91 LLLCLLCRLLCLLYSQRRRLTSLAPLHLFHFACGLII 127 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,650,201 Number of Sequences: 219361 Number of extensions: 1602112 Number of successful extensions: 3193 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3193 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)