| Clone Name | rbags38a09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TFE3_HUMAN (P19532) Transcription factor E3 | 34 | 0.43 | 2 | TFE3_MOUSE (Q64092) Transcription factor E3 (Fragment) | 33 | 0.96 | 3 | 8511_TRYCR (P18269) Sialidase 85-1.1 precursor (EC 3.2.1.18) (Ne... | 30 | 8.1 |
|---|
>TFE3_HUMAN (P19532) Transcription factor E3| Length = 743 Score = 33.9 bits (76), Expect = 0.43 Identities = 22/71 (30%), Positives = 32/71 (45%) Frame = +1 Query: 223 SQIQIQILLRNSRT*FRHNLFIWARKFN*NHRIP*KTESNPCLSSK*THWRKGFLLMSML 402 S+ + + LL+ + HNL R+FN N RI P S W KG +L + + Sbjct: 334 SETEAKALLKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSSDPEMRWNKGTILKASV 393 Query: 403 DIIYKIGNSDQ 435 D I K+ Q Sbjct: 394 DYIRKLQKEQQ 404
>TFE3_MOUSE (Q64092) Transcription factor E3 (Fragment)| Length = 446 Score = 32.7 bits (73), Expect = 0.96 Identities = 21/71 (29%), Positives = 32/71 (45%) Frame = +1 Query: 223 SQIQIQILLRNSRT*FRHNLFIWARKFN*NHRIP*KTESNPCLSSK*THWRKGFLLMSML 402 S+ + + LL+ + HNL R+FN N RI P + W KG +L + + Sbjct: 207 SETEAKALLKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPEMRWNKGTILKASV 266 Query: 403 DIIYKIGNSDQ 435 D I K+ Q Sbjct: 267 DYIRKLQKEQQ 277
>8511_TRYCR (P18269) Sialidase 85-1.1 precursor (EC 3.2.1.18) (Neuraminidase)| (NA) (Major 85 kDa surface antigen) (SA85-1.1 protein) Length = 752 Score = 29.6 bits (65), Expect = 8.1 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 11/78 (14%) Frame = +1 Query: 430 DQTVCILAILSEACQ----YLCSEPSSRNSPSVEVPSGNWIDDRLT-----VPLILRLPT 582 D+ +C+ A ++ A + + +EP SR SV +P GN L+ V ++ Sbjct: 487 DEYLCLNATVTNATKVKDGFQLTEPDSRAVWSVNIPDGNVRHISLSHNFTLVASVIIEEA 546 Query: 583 VGGSTP--GA*LLDAGPE 630 G+TP A L+DAGPE Sbjct: 547 PSGNTPLLTAVLVDAGPE 564 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,202,204 Number of Sequences: 219361 Number of extensions: 2110433 Number of successful extensions: 4043 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3945 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4043 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)