| Clone Name | rbags37j19 |
|---|---|
| Clone Library Name | barley_pub |
>KCNG2_RAT (Q9QYU3) Potassium voltage-gated channel subfamily G member 2| (Voltage-gated potassium channel subunit Kv6.2) (Cardiac potassium channel subunit) Length = 480 Score = 30.8 bits (68), Expect = 3.4 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Frame = -2 Query: 143 CHDPCR---CL*TICVFWFKFMA*ISSAFMYQ*CGYFSGPRCVVNIRAIL 3 C CR L T+CV WF F + S C + P +++I AIL Sbjct: 224 CSTKCRNLFVLETVCVAWFSFEFLLRSLQAESKCAFLRTPLAIIDILAIL 273
>ATG26_YARLI (Q6C8M8) Sterol 3-beta-glucosyltransferase (EC 2.4.1.173)| (Autophagy-related protein 26) Length = 1424 Score = 30.4 bits (67), Expect = 4.4 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -1 Query: 534 FQQTFECLPDEKLKKAYACYLSTSHGPIMGVLYVSTAKLAFCS 406 FQ+ F +E+L +Y C+L P G +YVST + F S Sbjct: 797 FQKRFALGTEERLIASYHCHLHRGGIPTYGKMYVSTNYVTFRS 839
>S230_PLAFO (P68875) Transmission-blocking target antigen S230 precursor| Length = 3135 Score = 30.4 bits (67), Expect = 4.4 Identities = 16/64 (25%), Positives = 28/64 (43%) Frame = -1 Query: 570 SKVKAEGGYDKIFQQTFECLPDEKLKKAYACYLSTSHGPIMGVLYVSTAKLAFCSDSPVA 391 ++++ + +KI +TF K Y CY+ G I G+L+ K C + + Sbjct: 751 NQIEEDEHNEKIKMKTFFTQNIYKKNNIYPCYMKLYSGDIGGILFPKNIKSTTCFEEMIP 810 Query: 390 YVTE 379 Y E Sbjct: 811 YNKE 814
>S230_PLAF7 (P68874) Transmission-blocking target antigen S230 precursor| Length = 3135 Score = 30.4 bits (67), Expect = 4.4 Identities = 16/64 (25%), Positives = 28/64 (43%) Frame = -1 Query: 570 SKVKAEGGYDKIFQQTFECLPDEKLKKAYACYLSTSHGPIMGVLYVSTAKLAFCSDSPVA 391 ++++ + +KI +TF K Y CY+ G I G+L+ K C + + Sbjct: 751 NQIEEDEHNEKIKMKTFFTQNIYKKNNIYPCYMKLYSGDIGGILFPKNIKSTTCFEEMIP 810 Query: 390 YVTE 379 Y E Sbjct: 811 YNKE 814
>KCNG2_HUMAN (Q9UJ96) Potassium voltage-gated channel subfamily G member 2| (Voltage-gated potassium channel subunit Kv6.2) (Cardiac potassium channel subunit) Length = 466 Score = 29.6 bits (65), Expect = 7.5 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Frame = -2 Query: 143 CHDPCRCL*---TICVFWFKFMA*ISSAFMYQ*CGYFSGPRCVVNIRAIL 3 C CR L T+CV WF F + S C + P +++I A+L Sbjct: 211 CSPKCRSLFVLETVCVAWFSFEFLLRSLQAESKCAFLRAPLNIIDILALL 260
>Y1265_HAEIN (P44144) Hypothetical UPF0142 protein HI1265| Length = 587 Score = 29.6 bits (65), Expect = 7.5 Identities = 29/94 (30%), Positives = 47/94 (50%), Gaps = 11/94 (11%) Frame = +1 Query: 199 ETLHSAVVVDEAHEPEVMVINRNYLDVPLCRILLTSGRGD*SQMRYRYNYLV--NGGLG- 369 E ++ + + A E EV V++ N+LDV CRI++ G D Y + L+ N +G Sbjct: 355 EEYNNLMAIFRADEKEVYVMDYNHLDVYACRIIV-PGMSD----IYPADDLIYANNNMGM 409 Query: 370 -----LIILSDICHGAVTTK---SKLGGRDVQDA 447 L+ L + H A T + +L G+D+ DA Sbjct: 410 DWREILLDLPNWHHDAETYQELLEELDGQDIDDA 443 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,799,714 Number of Sequences: 219361 Number of extensions: 1889209 Number of successful extensions: 4457 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4456 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)