| Clone Name | rbaal2e20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HISZ_RALSO (Q8Y020) ATP phosphoribosyltransferase regulatory sub... | 31 | 3.6 | 2 | FANCL_HUMAN (Q9NW38) Ubiquitin ligase protein FANCL (EC 6.3.2.-)... | 30 | 8.0 |
|---|
>HISZ_RALSO (Q8Y020) ATP phosphoribosyltransferase regulatory subunit| Length = 386 Score = 30.8 bits (68), Expect = 3.6 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -3 Query: 619 LDKLKSVEFH-GGAAPKIELLQFRGWRYKANTVLFAGLPSLPSLKQVLLKGRYE 461 LD L ++ H GGAA I+L RG+ Y + + A + +P+ V GRY+ Sbjct: 240 LDDLATLAAHAGGAAVNIDLADLRGYHYHSGVMFAAYVAGVPN--AVARGGRYD 291
>FANCL_HUMAN (Q9NW38) Ubiquitin ligase protein FANCL (EC 6.3.2.-) (Fanconi| anemia group L protein) (Fanconi anemia-associated polypeptide of 43 kDa) (FAAP43) Length = 375 Score = 29.6 bits (65), Expect = 8.0 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = -1 Query: 249 RRIQSGHHAPANVSVGSKAPYMARFCFFVGLL*IGIDYCEKELGCRYGSKV 97 RRI G++ N+ V + P M CFF +G D+ K LG + + Sbjct: 226 RRIALGNNVSINIEVDPRHPTMLPECFF-----LGADHVVKPLGIKLSRNI 271 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,749,798 Number of Sequences: 219361 Number of extensions: 1977728 Number of successful extensions: 4513 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4510 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)