| Clone Name | rbags37i06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRPE_SYNY3 (P20170) Probable anthranilate synthase component 1 (... | 32 | 2.8 | 2 | CEBP_DROME (Q02637) CCAAT/enhancer-binding protein (C/EBP) (Slow... | 31 | 3.6 | 3 | YBG0_YEAST (P34225) Hypothetical 78.8 kDa protein in SKT5-SHP1 i... | 31 | 4.7 | 4 | CCNB2_RANJA (O93229) G2/mitotic-specific cyclin-B2 | 30 | 6.2 |
|---|
>TRPE_SYNY3 (P20170) Probable anthranilate synthase component 1 (EC 4.1.3.27)| (Anthranilate synthase component I) Length = 508 Score = 31.6 bits (70), Expect = 2.8 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Frame = +2 Query: 125 TLSRKPNLTGSSLPNMLKAT-----SSVLLYYGTEGVSNTHISKRTML*VERPDRLH 280 T+S P + + N L+ S V YY EG NT I+ RTM+ E+PD H Sbjct: 414 TVSGAPKIRAMEIINELEPERRGPYSGVYGYYDFEGQLNTAIAIRTMVVQEQPDGAH 470
>CEBP_DROME (Q02637) CCAAT/enhancer-binding protein (C/EBP) (Slow border cell| protein) Length = 449 Score = 31.2 bits (69), Expect = 3.6 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 52 HYKLHKPHMHTPHKAQEQHRNHQLHTIKK 138 H KLH H H+ Q+QHR H + K Sbjct: 333 HSKLHAQQQHQQHQQQQQHRKHSNKHVDK 361
>YBG0_YEAST (P34225) Hypothetical 78.8 kDa protein in SKT5-SHP1 intergenic| region Length = 687 Score = 30.8 bits (68), Expect = 4.7 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = -1 Query: 493 PPVGQSLISEINKHIEGHLCYEFPSTLNQLVSVDLEEGTWMSLRSESEETVVDIWEF 323 P +G L+ E K +E E L +L++ + G W+ +E ++ +V+IW F Sbjct: 592 PLLGLELLYEDAKDVE---MVELKERLKELMNFTRQLGIWIDKHNEIKDKLVEIWSF 645
>CCNB2_RANJA (O93229) G2/mitotic-specific cyclin-B2| Length = 392 Score = 30.4 bits (67), Expect = 6.2 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = -1 Query: 466 EINKHIEGHLCYEFPSTLNQLVSVDLEEGTWMSLRSESEETVVDIWEFI 320 +++ E LC F LN +V +D E+G L S E VVDI+ ++ Sbjct: 92 DVSMKEEEELCQAFSEVLNHVVDIDAEDGGNPQLCS---EYVVDIYNYL 137 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 107,222,872 Number of Sequences: 219361 Number of extensions: 2313044 Number of successful extensions: 6387 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5947 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6350 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7932903580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)