| Clone Name | rbags37h15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ECE1_BOVIN (P42891) Endothelin-converting enzyme 1 (EC 3.4.24.71... | 30 | 6.2 | 2 | GP158_MOUSE (Q8C419) Probable G-protein coupled receptor 158 pre... | 30 | 6.2 | 3 | IF3C_ORYSA (Q94HF1) Eukaryotic translation initiation factor 3 s... | 30 | 8.1 |
|---|
>ECE1_BOVIN (P42891) Endothelin-converting enzyme 1 (EC 3.4.24.71) (ECE-1)| Length = 754 Score = 30.0 bits (66), Expect = 6.2 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = -3 Query: 387 IISHDHTTPYLPE--SGDSKSSNSGLLDILPRGVQVP 283 + SH HT+P+ S DSK+SNS ++ + G+ +P Sbjct: 211 VTSHYHTSPFFSVYVSADSKNSNSNVIQVDQSGLGLP 247
>GP158_MOUSE (Q8C419) Probable G-protein coupled receptor 158 precursor| Length = 1200 Score = 30.0 bits (66), Expect = 6.2 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = -3 Query: 357 LPESGDSKSSNSGLLDILPRGVQVPVNSHEILYTLYDNLDFPVPPLREALLSNSVTMRSS 178 L + GD + S +DI+P NSH+ L + + + PL + SVT+ +S Sbjct: 1128 LNQMGDQEKQTSSSVDIIPGSCNSSNNSHQPLTSRAEVCPWEFEPLEQPNAERSVTLPAS 1187
>IF3C_ORYSA (Q94HF1) Eukaryotic translation initiation factor 3 subunit 12| (eIF-3 p25) (eIF3k) Length = 226 Score = 29.6 bits (65), Expect = 8.1 Identities = 20/72 (27%), Positives = 33/72 (45%) Frame = -3 Query: 423 HNIVRQQHKSEGIISHDHTTPYLPESGDSKSSNSGLLDILPRGVQVPVNSHEILYTLYDN 244 H + +Q K+ ++SH T + D S N +LD++P G + + S+ I Sbjct: 92 HVQMEEQFKTLIVLSHYLETARFRQFWDEASKNRNILDVVP-GFEQAIQSYAIHVLSLTY 150 Query: 243 LDFPVPPLREAL 208 P P L EA+ Sbjct: 151 QKVPRPVLAEAI 162 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,318,047 Number of Sequences: 219361 Number of extensions: 1839702 Number of successful extensions: 4421 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4416 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)