| Clone Name | rbags37e08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC ... | 29 | 8.3 | 2 | OGG1_RAT (O70249) N-glycosylase/DNA lyase [Includes: 8-oxoguanin... | 29 | 8.3 |
|---|
>UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) Length = 1102 Score = 29.3 bits (64), Expect = 8.3 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = -1 Query: 454 YLGLEHTDTTPKRSYTANQNRHTY-EKPVKIYN 359 +LGL+H + PKRS R+TY EK +KI+N Sbjct: 1076 WLGLDHFNKAPKRS------RYTYLEKAIKIHN 1102
>OGG1_RAT (O70249) N-glycosylase/DNA lyase [Includes: 8-oxoguanine DNA| glycosylase (EC 3.2.2.-); DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) (AP lyase)] Length = 345 Score = 29.3 bits (64), Expect = 8.3 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = -2 Query: 369 RSTIEKPSIWAACPCPDKGLI*ESVLKRPSDLNRREMLSNIWSFV 235 R+ P++WA+ PCP L + VL RE WS V Sbjct: 14 RTLTSSPALWASIPCPRSELRLDLVLASGQSFRWREQSPAHWSGV 58 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,106,442 Number of Sequences: 219361 Number of extensions: 1987342 Number of successful extensions: 4553 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4419 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4553 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4815021120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)