| Clone Name | rbags37e03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CLPX_TREDE (Q73M37) ATP-dependent Clp protease ATP-binding subun... | 30 | 2.4 |
|---|
>CLPX_TREDE (Q73M37) ATP-dependent Clp protease ATP-binding subunit clpX| Length = 415 Score = 29.6 bits (65), Expect = 2.4 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +1 Query: 43 SIHKHWSRVLNPQTENRRIALVISIAMLGPT 135 +++ H+ R++NP EN + ++ +LGPT Sbjct: 88 AVYNHYKRIMNPPLENDVVIEKSNVLLLGPT 118 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.128 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,971,855 Number of Sequences: 219361 Number of extensions: 178485 Number of successful extensions: 417 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 80,573,946 effective HSP length: 21 effective length of database: 75,967,365 effective search space used: 1823216760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)