| Clone Name | rbags37e02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RSE1_KLULA (Q6CXH8) Pre-mRNA-splicing factor RSE1 | 30 | 5.0 | 2 | RDRP_PVXHB (Q07630) RNA replication protein (165 kDa protein) (O... | 29 | 6.6 |
|---|
>RSE1_KLULA (Q6CXH8) Pre-mRNA-splicing factor RSE1| Length = 1269 Score = 29.6 bits (65), Expect = 5.0 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = -1 Query: 155 SSGI*RCLYLLDVIIQCYMHLTPSFYELVNYVFLLLGQSLWW 30 +S I C Y L+ + YM+ TP +E+VN++ + ++ W Sbjct: 1086 ASNIKACQYTLETLCHMYMNDTPMKFEIVNHMNMSDRPAILW 1127
>RDRP_PVXHB (Q07630) RNA replication protein (165 kDa protein) (ORF 1 protein)| [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); Helicase (EC 3.6.1.-)] Length = 1456 Score = 29.3 bits (64), Expect = 6.6 Identities = 17/66 (25%), Positives = 27/66 (40%) Frame = +2 Query: 95 GAYNTEL*HQEGTNISKCHWRHKGFR*QTVHQHQNSRKTDTSSHFANLHYKWTFLAGHLA 274 GAY+ E H + + K WR + H N +H + + +F A HL Sbjct: 212 GAYHHEFSHLQSVKVGKIKWRDPK---DGLLGHLNYTHEQVDTHTVTVQLQESFAANHLY 268 Query: 275 LEQRGS 292 +RG+ Sbjct: 269 CIRRGN 274 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,946,843 Number of Sequences: 219361 Number of extensions: 1141893 Number of successful extensions: 2477 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2476 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)