| Clone Name | rbags37c15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LY6E_CHICK (Q90986) Lymphocyte antigen Ly-6E precursor (Stem cel... | 31 | 2.6 | 2 | OS9_CANAL (Q5ACR4) Protein OS-9 homolog precursor | 31 | 2.6 | 3 | MTAL2_PICAN (Q707Y8) Mating-type protein ALPHA2 (MATalpha2 trans... | 30 | 7.5 | 4 | DYR_MYCGE (P47470) Dihydrofolate reductase (EC 1.5.1.3) | 30 | 7.5 |
|---|
>LY6E_CHICK (Q90986) Lymphocyte antigen Ly-6E precursor (Stem cell antigen 2)| (SCA-2) Length = 126 Score = 31.2 bits (69), Expect = 2.6 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = -1 Query: 424 EKTGNHLCFKCSSATSNFGANCCTISKCTILPSIVANHCTNEHHCLT 284 E+ +CF CS A+SN+ C T KC NE HC+T Sbjct: 16 ERAHTLICFSCSDASSNWA--CLTPVKC----------AENEEHCVT 50
>OS9_CANAL (Q5ACR4) Protein OS-9 homolog precursor| Length = 258 Score = 31.2 bits (69), Expect = 2.6 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +2 Query: 515 FSFNIHGRYFLAWYL--IDCISFHSNIPDCVS 604 FSFN+H Y+ Y I+ I FH N+ D +S Sbjct: 118 FSFNLHANYWTIGYCHGINVIQFHENLDDFIS 149
>MTAL2_PICAN (Q707Y8) Mating-type protein ALPHA2 (MATalpha2 transcription| factor) Length = 163 Score = 29.6 bits (65), Expect = 7.5 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 140 DKTVAIQKELCFHISQDTRLPPNDI 214 ++T+ I KEL ++QDTR PND+ Sbjct: 138 ERTLTISKELSDLLNQDTRCSPNDV 162
>DYR_MYCGE (P47470) Dihydrofolate reductase (EC 1.5.1.3)| Length = 160 Score = 29.6 bits (65), Expect = 7.5 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = -2 Query: 621 LIQLWKLTQSGMLE*KLMQSMRYQARKYLPWMLKLKLAQQKQMSEVAAYLM 469 LI +W +TQ G++ LPWM+K +LA K+ + A LM Sbjct: 2 LIAIWAMTQEGLIG----------NNNTLPWMIKQELAHFKKTTLFQALLM 42 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,351,759 Number of Sequences: 219361 Number of extensions: 1497386 Number of successful extensions: 3053 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2967 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3052 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)