| Clone Name | rbags37b15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GUX1_HUMGT (P15828) Exoglucanase 1 precursor (EC 3.2.1.91) (Exog... | 29 | 5.2 |
|---|
>GUX1_HUMGT (P15828) Exoglucanase 1 precursor (EC 3.2.1.91) (Exoglucanase I)| (Exocellobiohydrolase I) (1,4-beta-cellobiohydrolase) (Beta-glucancellobiohydrolase) Length = 525 Score = 29.3 bits (64), Expect = 5.2 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 297 TIXVMLTYDSRRRRRSTPSGATMCYFQNKW 208 T+ +T DS R SG+T CY NKW Sbjct: 45 TVQASITLDSNWRWTHQVSGSTNCYTGNKW 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,336,981 Number of Sequences: 219361 Number of extensions: 639092 Number of successful extensions: 1323 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1314 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1323 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)