| Clone Name | rbaal1p02 |
|---|---|
| Clone Library Name | barley_pub |
>WRK31_ARATH (Q93WT0) Probable WRKY transcription factor 31 (WRKY DNA-binding| protein 31) Length = 538 Score = 40.8 bits (94), Expect = 0.002 Identities = 22/44 (50%), Positives = 29/44 (65%), Gaps = 2/44 (4%) Frame = -3 Query: 488 PRQPMGLPG--QLSDSVSXXXXAITADPNFTVALAAAISSIMAG 363 P QP+ + +++SVS AI +DPNF ALAAAI+SIM G Sbjct: 473 PAQPLQIAATSSVAESVSAASAAIASDPNFAAALAAAITSIMNG 516
>WRK47_ARATH (Q9ZSI7) Probable WRKY transcription factor 47 (WRKY DNA-binding| protein 47) Length = 489 Score = 36.6 bits (83), Expect = 0.043 Identities = 20/39 (51%), Positives = 24/39 (61%) Frame = -3 Query: 479 PMGLPGQLSDSVSXXXXAITADPNFTVALAAAISSIMAG 363 P P ++ DSV I DPNFT ALAAAIS+I+ G Sbjct: 413 PQAPPREMVDSVRAA---IAMDPNFTAALAAAISNIIGG 448
>WRKY6_ARATH (Q9C519) WRKY transcription factor 6 (WRKY DNA-binding protein 6)| (AtWRKY6) Length = 553 Score = 36.2 bits (82), Expect = 0.056 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = -3 Query: 455 SDSVSXXXXAITADPNFTVALAAAISSIMAG 363 S +V+ A+TADPNFT ALAA ISS++ G Sbjct: 510 SHAVADTITALTADPNFTAALAAVISSMING 540
>WRK42_ARATH (Q9XEC3) Probable WRKY transcription factor 42 (WRKY DNA-binding| protein 42) Length = 528 Score = 36.2 bits (82), Expect = 0.056 Identities = 20/44 (45%), Positives = 27/44 (61%) Frame = -3 Query: 488 PRQPMGLPGQLSDSVSXXXXAITADPNFTVALAAAISSIMAGQH 357 P QP+ +SVS AI ++PNF ALAAAI+SI+ G + Sbjct: 468 PSQPLNA----GESVSAATAAIASNPNFAAALAAAITSIINGSN 507
>WRK40_ARATH (Q9SAH7) Probable WRKY transcription factor 40 (WRKY DNA-binding| protein 40) Length = 302 Score = 32.0 bits (71), Expect = 1.1 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -3 Query: 518 DSVDAGQFAQPRQPMGLPGQLSDSVSXXXXAITADPNFTVALAAAISSIMAGQH 357 D +++ + P + P V ++T DPNFT ALAAA++ + Q+ Sbjct: 245 DMIESKKVTSPTSRIDFPQVQKLLVEQMASSLTKDPNFTAALAAAVTGKLYQQN 298
>WRK61_ARATH (Q8VWV6) Probable WRKY transcription factor 61 (WRKY DNA-binding| protein 61) Length = 480 Score = 30.4 bits (67), Expect = 3.1 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 425 ITADPNFTVALAAAISSIMAG 363 IT DP+F ALA A+SSIM G Sbjct: 443 ITTDPSFQSALATALSSIMGG 463
>EXOW_RHIME (P33702) Succinoglycan biosynthesis protein exoW (EC 2.-.-.-)| Length = 319 Score = 28.9 bits (63), Expect = 9.0 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -1 Query: 190 WMVFHSSLVRIS---FSRSLFGLDTKHDIRSLLFFCDFAAAKKKVVL 59 W H S + I F + F K +LFFCD A K+VVL Sbjct: 166 WSFLHMSCMVIGRKLFEKVRFEATLKLAAEDVLFFCDCVLASKRVVL 212 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,878,358 Number of Sequences: 219361 Number of extensions: 896400 Number of successful extensions: 2368 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2368 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)