| Clone Name | rbaal2e06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FABH_PORPU (P51196) 3-oxoacyl-[acyl-carrier-protein] synthase 3 ... | 30 | 6.2 | 2 | CIAS1_MOUSE (Q8R4B8) Cold autoinflammatory syndrome 1 protein ho... | 30 | 8.0 |
|---|
>FABH_PORPU (P51196) 3-oxoacyl-[acyl-carrier-protein] synthase 3 (EC 2.3.1.41)| (3-oxoacyl-[acyl-carrier-protein] synthase III) (Beta-ketoacyl-ACP synthase III) (KAS III) Length = 326 Score = 30.4 bits (67), Expect = 6.2 Identities = 26/91 (28%), Positives = 38/91 (41%), Gaps = 2/91 (2%) Frame = +2 Query: 467 WLTTPSGGSHSHWLSDSKEATYFAILAANDFLSPACLL*SILNFIACFSRT--SIQSKAR 640 W++T +G H S T A AAND LS A + ++ I + T + A Sbjct: 32 WISTRTGIKKRHLAPSSTSLTKLAAEAANDALSKASINAEDIDLIILATSTPDDLFGSAS 91 Query: 641 SYSIVLG*EQCDVDTAFFCSSRCLGFIF*LL 733 +G TAF ++ C GFI L+ Sbjct: 92 QLQAEIG---ATSSTAFDITAACSGFIIALV 119
>CIAS1_MOUSE (Q8R4B8) Cold autoinflammatory syndrome 1 protein homolog| (PYRIN-containing APAF1-like protein 1) (Mast cell maturation-associated inducible protein 1) (Cryopyrin) Length = 1033 Score = 30.0 bits (66), Expect = 8.0 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = +1 Query: 487 RFPFPLVKRFQRSYLLRHLGCKRLPLTRVPLMKYTELHCLLFSDKHPIQGQIIFYCV 657 RF F LV + + SYL + L CK R+ L+K+ E+ + +FYC+ Sbjct: 576 RFLFGLVNQERTSYLEKKLSCKISQQVRLELLKWIEVKAKAKKLQWQPSQLELFYCL 632 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 106,977,219 Number of Sequences: 219361 Number of extensions: 2192269 Number of successful extensions: 4800 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4681 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4800 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7932903580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)