| Clone Name | rbags37a07 |
|---|---|
| Clone Library Name | barley_pub |
>TOP1_ARATH (P30181) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| Length = 916 Score = 32.7 bits (73), Expect = 0.87 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 481 VYKWMLEEKRKSKPRDAAEKNKINEEKALLKE 386 +Y+W LEEK K K EK + EEK +E Sbjct: 455 IYEWHLEEKEKKKQMSTEEKKALKEEKMKQEE 486
>MOES_HUMAN (P26038) Moesin (Membrane-organizing extension spike protein)| Length = 576 Score = 30.0 bits (66), Expect = 5.7 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -3 Query: 499 EDEQRQVYKWMLEEKRKSKPRDAAEKNKINEEKALLKEIIR 377 E Q+Q+ + MLE ++K + EK KI EK L E ++ Sbjct: 311 EKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMERLK 351
>RS16_PROMA (Q7VAU5) 30S ribosomal protein S16| Length = 131 Score = 29.6 bits (65), Expect = 7.4 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = -3 Query: 463 EEKRKSKPRDAAEKNKINEEKALLKEIIRAESL 365 EE RKS+ + +A+ K NEEKA +++ +E+L Sbjct: 93 EELRKSEAKTSAKNKKANEEKANEEKVEESETL 125
>DHYS_RAT (Q6AY53) Deoxyhypusine synthase (EC 2.5.1.46) (DHS)| Length = 369 Score = 29.6 bits (65), Expect = 7.4 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -2 Query: 305 AIPVRVYFITNLVF-LAVTNSMALRADTFHSQKN 207 A PV+VY +LVF L V + A +AD F ++KN Sbjct: 334 AQPVKVYADASLVFPLLVAETFAQKADAFRAEKN 367
>RFNG_CHICK (O12972) Beta-1,3-N-acetylglucosaminyltransferase radical fringe| (EC 2.4.1.222) (O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase) Length = 372 Score = 29.3 bits (64), Expect = 9.7 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -2 Query: 296 VRVYFITNLVFLAVTNSMALRADTFHSQKN*VTPVSRKRFPFRCTI-MMMESILEI 132 V+ +F T ++ +AL+ + S N ++ R R P CTI ++E +LE+ Sbjct: 241 VKFWFATGGAGFCISRGLALKMSPWASLGNFISTAERVRLPDDCTIGYIIEGLLEV 296
>AXN2_HUMAN (Q9Y2T1) Axin-2 (Axis inhibition protein 2) (Conductin) (Axin-like| protein) (Axil) Length = 843 Score = 29.3 bits (64), Expect = 9.7 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -3 Query: 496 DEQRQVYKWMLEEKRKSKPR 437 D + V++WMLE +R+SKP+ Sbjct: 614 DRSQDVWQWMLESERQSKPK 633 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,857,099 Number of Sequences: 219361 Number of extensions: 1389735 Number of successful extensions: 3716 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3714 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)