| Clone Name | rbags37a06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AHM4_ARATH (Q9SZW5) Putative cadmium/zinc-transporting ATPase 4 ... | 30 | 2.2 | 2 | AHM2_ARATH (O64474) Putative cadmium/zinc-transporting ATPase 2 ... | 28 | 4.9 | 3 | HAK7_ORYSA (Q8H3P9) Potassium transporter 7 (OsHAK7) | 28 | 8.4 |
|---|
>AHM4_ARATH (Q9SZW5) Putative cadmium/zinc-transporting ATPase 4 (EC 3.6.3.3)| (EC 3.6.3.5) Length = 760 Score = 29.6 bits (65), Expect = 2.2 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -2 Query: 156 VLVTGANSITAHLVFRYPCFDFFFHFLLYTRVAILNCGILLTXPVAXXCFL 4 V+V+ A ++ + +FH L V+ CG++L+ PVA C L Sbjct: 319 VVVSAACFAVIPVLLKVQDLSHWFHLALVVLVSGCPCGLILSTPVATFCAL 369
>AHM2_ARATH (O64474) Putative cadmium/zinc-transporting ATPase 2 (EC 3.6.3.3)| (EC 3.6.3.5) Length = 1172 Score = 28.5 bits (62), Expect = 4.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 90 FFHFLLYTRVAILNCGILLTXPVAXXCFL 4 +FH L V+ CG++L+ PVA C L Sbjct: 345 WFHLALVVLVSGCPCGLILSTPVATFCAL 373
>HAK7_ORYSA (Q8H3P9) Potassium transporter 7 (OsHAK7)| Length = 811 Score = 27.7 bits (60), Expect = 8.4 Identities = 19/53 (35%), Positives = 23/53 (43%) Frame = -2 Query: 213 VRQPGGGEVYTVTEHEAFDVLVTGANSITAHLVFRYPCFDFFFHFLLYTRVAI 55 VR PG G +YT LVTG SI +H V P F F+ V + Sbjct: 553 VRVPGIGLIYTE--------LVTGVPSIFSHFVTNLPAFHQVLVFVCVKSVPV 597 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,205,847 Number of Sequences: 219361 Number of extensions: 385523 Number of successful extensions: 827 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 827 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)