| Clone Name | rbaal2e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KBTB7_HUMAN (Q8WVZ9) Kelch repeat and BTB domain-containing prot... | 28 | 5.7 | 2 | UXAC_XANAC (Q8PET9) Uronate isomerase (EC 5.3.1.12) (Glucuronate... | 28 | 5.7 | 3 | SPL10_ARATH (Q8S9L0) Squamosa promoter-binding-like protein 10 | 27 | 9.7 |
|---|
>KBTB7_HUMAN (Q8WVZ9) Kelch repeat and BTB domain-containing protein 7| Length = 684 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 210 VVYYYYKTRQAQWWNITFSTK*TQMDDGFI 299 V Y Y TR+ QW NI Q D GFI Sbjct: 583 VTVYEYDTREDQWINIGTMLGLLQFDSGFI 612
>UXAC_XANAC (Q8PET9) Uronate isomerase (EC 5.3.1.12) (Glucuronate isomerase)| (Uronic isomerase) Length = 472 Score = 28.1 bits (61), Expect = 5.7 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 251 EHHVFY*VNPNGRWIHHVNHEVFQAKCR 334 EH+ P+ W++HV H+VF + R Sbjct: 105 EHYTLLRGTPSALWLNHVFHDVFDLRIR 132
>SPL10_ARATH (Q8S9L0) Squamosa promoter-binding-like protein 10| Length = 396 Score = 27.3 bits (59), Expect = 9.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 228 KTRQAQWWNITFSTK*TQMDDGFIMS 305 ++ + W T+ TK TQM+ GF +S Sbjct: 280 RSEEKYTWGTTYETKPTQMESGFTLS 305 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,982,718 Number of Sequences: 219361 Number of extensions: 840659 Number of successful extensions: 1616 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1616 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)