>ROM1_BOVIN (P52205) Rod outer segment membrane protein 1 (ROSP1)|
          Length = 351

 Score = 27.7 bits (60), Expect = 8.9
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = -2

Query: 140 RIKVVXGRWWXCVREFVCLVSVLSL-CPANASVSIWHLCLFFRPWXP 3
           RI++V G W   +   + LV  L+L C  +  V +WHL  F  P  P
Sbjct: 14  RIRLVQGLW--LLSWLLVLVGGLTLLCSGHLLVQLWHLGTFLAPSCP 58


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,591,927
Number of Sequences: 219361
Number of extensions: 172045
Number of successful extensions: 357
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 357
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 357
length of database: 80,573,946
effective HSP length: 30
effective length of database: 73,993,116
effective search space used: 1775834784
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)