| Clone Name | rbags36h10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CARB_CAUCR (Q9A4D6) Carbamoyl-phosphate synthase large chain (EC... | 31 | 0.89 | 2 | HEM32_STRCO (Q9KY00) Porphobilinogen deaminase 2 (EC 2.5.1.61) (... | 29 | 2.6 | 3 | HEM32_STRAW (Q82P95) Porphobilinogen deaminase 2 (EC 2.5.1.61) (... | 28 | 7.5 |
|---|
>CARB_CAUCR (Q9A4D6) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1099 Score = 30.8 bits (68), Expect = 0.89 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 14 VSIQFSMNDPHSNNMFMLHRVDSKPRLSVPTVNPRVQRKKP 136 +++QF++ +PHS+N PR+ V VNPR R P Sbjct: 838 MNVQFAIEEPHSDN----------PRIYVLEVNPRASRTVP 868
>HEM32_STRCO (Q9KY00) Porphobilinogen deaminase 2 (EC 2.5.1.61) (PBG 2)| (Hydroxymethylbilane synthase 2) (HMBS 2) (Pre-uroporphyrinogen synthase 2) Length = 313 Score = 29.3 bits (64), Expect = 2.6 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -2 Query: 259 LPAHEHAAYQGHAPIFKCXN*LVCAAYEFSHDGKEVFNSHAWLFPLDP 116 L H ++ GHA + + L A F+ DGK N+H W LDP Sbjct: 242 LQGHCNSPIAGHAQVDRSGE-LSLRACVFTPDGKVRLNAHEWAGRLDP 288
>HEM32_STRAW (Q82P95) Porphobilinogen deaminase 2 (EC 2.5.1.61) (PBG 2)| (Hydroxymethylbilane synthase 2) (HMBS 2) (Pre-uroporphyrinogen synthase 2) Length = 314 Score = 27.7 bits (60), Expect = 7.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 175 FSHDGKEVFNSHAWLFPLDP 116 F+ DGK V N+H W LDP Sbjct: 270 FTLDGKTVLNAHEWAGRLDP 289 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,263,273 Number of Sequences: 219361 Number of extensions: 766265 Number of successful extensions: 1824 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1823 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)