| Clone Name | rbags36f09 |
|---|---|
| Clone Library Name | barley_pub |
>PYRG_PYRFU (Q8TZY6) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 537 Score = 30.0 bits (66), Expect = 1.6 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +1 Query: 1 QHXKNSNRLSMTHISQIKANKVVGEHAXT*NQHSIQRTRGLG 126 Q + + ++ H++ + KVVGE QHS++ R LG Sbjct: 160 QLEEGRDNVAFVHVTYVPKLKVVGEQKTKPTQHSVKELRSLG 201
>PYRG_PYRHO (O59456) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 537 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 1 QHXKNSNRLSMTHISQIKANKVVGEHAXT*NQHSIQRTRGLG 126 Q + ++ H++ + KVVGE QHS++ R LG Sbjct: 160 QLEEGRENVAFVHVTYVPKLKVVGEQKTKPTQHSVKELRSLG 201
>PYRG_CHLCV (Q822T2) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 537 Score = 29.6 bits (65), Expect = 2.1 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 1 QHXKNSNRLSMTHISQIKANKVVGEHAXT*NQHSIQRTRGLG 126 +H N + MT++ +KA GE QHS+Q RG+G Sbjct: 165 EHAANCFSIHMTYVPYLKA---AGEVKTKPTQHSVQSLRGIG 203
>PYRG_PYRAB (Q9V1S2) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 537 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +1 Query: 1 QHXKNSNRLSMTHISQIKANKVVGEHAXT*NQHSIQRTRGLG 126 Q + ++ H++ + +VVGE QHS++ R LG Sbjct: 160 QLEEGRENVAFVHVTYVPKLRVVGEQKTKPTQHSVKELRSLG 201
>PYRG_PYRKO (Q5JGF1) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 533 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +1 Query: 1 QHXKNSNRLSMTHISQIKANKVVGEHAXT*NQHSIQRTRGLG 126 Q + ++ H++ + +VVGE QHS++ R LG Sbjct: 160 QIEEGRENVAFVHVTYVPRLRVVGEQKTKPTQHSVKELRSLG 201
>BPA1_HUMAN (Q03001) Bullous pemphigoid antigen 1 isoforms 1/2/3/4/5/8 (230 kDa| bullous pemphigoid antigen) (BPA) (Hemidesmosomal plaque protein) (Dystonia musculorum protein) (Dystonin) (Fragment) Length = 3214 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +2 Query: 197 PFCLEPATSSSSCRGMSGLQRQH 265 P C P T ++SCR ++GLQ++H Sbjct: 1901 PVC--PITQATSCRAVTGLQQEH 1921 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,761,245 Number of Sequences: 219361 Number of extensions: 562373 Number of successful extensions: 1284 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1284 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)