| Clone Name | rbags36e18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y2066_MYCLE (O32912) Hypothetical protein ML2066 | 28 | 8.1 |
|---|
>Y2066_MYCLE (O32912) Hypothetical protein ML2066| Length = 478 Score = 27.7 bits (60), Expect = 8.1 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 15/47 (31%) Frame = -1 Query: 162 LQEIVSYRKSPSLVI---------------TRLLHRTPHGVAIVSYE 67 +Q+ V + KS LVI T L+H+ HGVA+V++E Sbjct: 82 VQQAVEFVKSRDLVIDTPVLLTPNDSVSDATTLIHKRAHGVAVVAFE 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,723,840 Number of Sequences: 219361 Number of extensions: 763091 Number of successful extensions: 1635 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1635 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)