| Clone Name | rbags36e12 |
|---|---|
| Clone Library Name | barley_pub |
>OPSD_SEPOF (O16005) Rhodopsin| Length = 464 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 19 CMLDYDTTGTMTASNIVGSLFFTFPFNR*FIYYCF 123 C DY T + T SNIV F F F I++C+ Sbjct: 186 CSFDYITRDSATRSNIVCMYIFAFCFPILIIFFCY 220
>OPSD_LOLSU (Q17094) Rhodopsin (Fragment)| Length = 439 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 Query: 19 CMLDYDTTGTMTASNIVGSLFFTFPFNR*FIYYCF 123 C DY T T SNIV F F F I++C+ Sbjct: 179 CSFDYITRDASTRSNIVCMYIFAFMFPIVVIFFCY 213
>POLN_SFV (P08411) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: P123; mRNA capping enzyme nsP1 (EC 2.1.1.-) (EC 2.7.7.-) (Nonstructural protein 1); Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-) (EC 3.1.3.33) (EC 3.6.1.15 Length = 2432 Score = 28.1 bits (61), Expect = 5.4 Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 4/70 (5%) Frame = +3 Query: 54 SIKHCGIPFLYFPFQPLIHLLLF----SGITILICTIYPEKQGMQNSFNHLQPXPEARDI 221 S++ C I +Y P P++ +GI L ++PE + N + P R Sbjct: 1695 SLQSCDIDSIYEPMAPIVVTADVHPEPAGIADLAADVHPEPADHVDLENPIPPPRPKRAA 1754 Query: 222 YIRNLATENP 251 Y+ + A E P Sbjct: 1755 YLASRAAERP 1764
>SRG17_CAEEL (O17820) Serpentine receptor class gamma-17 (Protein srg-17)| Length = 320 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -3 Query: 248 IFCCEVTYINISCLWXWLQMIERILHSLFFRINCTY 141 I C VT+ ++CL ++ IER L I+CT+ Sbjct: 211 IVCTSVTFYKLACLSDRVRSIERSLCFTSISISCTF 246
>YMF19_WHEAT (P43650) Hypothetical protein ymf19 (ORF156) (18 kDa membrane-bound| protein) Length = 156 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 300 LISKGGRHRSSSPKHLQDFLLRGY 229 L +GG RS PK+L+D L +G+ Sbjct: 48 LSHRGGEIRSKDPKNLEDILRKGF 71
>OPSD_LOLFO (P24603) Rhodopsin| Length = 452 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 19 CMLDYDTTGTMTASNIVGSLFFTFPFNR*FIYYCF 123 C DY T T T SNI+ F F I++C+ Sbjct: 186 CSFDYITRDTTTRSNILCMYIFAFMCPIVVIFFCY 220
>RNAS8_AOTTR (Q8SPZ5) Ribonuclease 8 precursor (EC 3.1.27.-) (RNase 8)| Length = 155 Score = 27.3 bits (59), Expect = 9.3 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 4/50 (8%) Frame = +3 Query: 99 PLIHLLLFSGITILICTIYPEKQGMQNS--FN--HLQPXPEARDIYIRNL 236 PL+ LLL G+ + + + +GM +S FN H+QP P+A D +R++ Sbjct: 10 PLL-LLLLLGLWVAEIPVSAKPEGMTSSQWFNTQHVQPSPQACDSAMRDI 58
>IDH_AZOVI (P16100) Isocitrate dehydrogenase [NADP] (EC 1.1.1.42)| (Oxalosuccinate decarboxylase) (IDH) Length = 740 Score = 27.3 bits (59), Expect = 9.3 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 7/47 (14%) Frame = -2 Query: 345 MFPLRRIPXX---YSXINLISKGGRHRS----SSPKHLQDFLLRGYV 226 +FP+ + S + L+S GG + S+PKH+Q FL GY+ Sbjct: 552 LFPIMELGTSAKMLSIVPLMSGGGLFETGAGGSAPKHVQQFLEEGYL 598
>Y010_CHLAB (Q5L7A0) UPF0176 protein CAB010| Length = 326 Score = 27.3 bits (59), Expect = 9.3 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +3 Query: 105 IHLLLFSGITILICTIYPEKQGMQNSFNHLQPXPEARDIYIRNLATENPG 254 +H LF + + C IY +QG+ F+ QP E Y N + PG Sbjct: 25 LHKELFKDLDVS-CRIYISEQGINGQFSGYQPDAE----YYMNWLRQRPG 69 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,828,476 Number of Sequences: 219361 Number of extensions: 825523 Number of successful extensions: 1583 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1583 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)